Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000062825 (Actg1)
Chromosomal location
Chr 11: 120207004 - 120209806 (-)
Description
actin, gamma, cytoplasmic 1 Gene [Source:MGI (curated);Acc:Actg1-001]
Human Ortholog
not available
Omim not available
UniTrap UNI38621
Vector Insertion
Chr 11: 120209277 - 120209412
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000106216
Sequence
ATGGAAGAAGAAATCGCCGCACTCGTCATTGACAATGGCTCCGGCATGTGCAAAGCCGGCTTTGCTGGCGACGACGCCCCCAGGGCCGTGTTCCCTTCCA

TCGTAGGGCGCCCCCGACACCAGGTTAG - UNI38621 - GCAGGGCGTCATGGTGGGCATGGGCCAGAAAGACTCATACGTGGGTGACGAGGCCCAG

AGCAAGAGGGGTATCCTGACCCTGAAGTACCCTATCGAACACGGCATTGTCACTAACTGGGACGACATGGAGAAGATCTGGCACCACACCTTCTACAATG

AGCTGCGTGTGGCTCCTGAGGAGCACCCGGTGCTTCTGACCGAGGCCCCCCTGAACCCCAAAGCTAACAGAGAGAAGATGACGCAG ATAATGTTTGAAA

CCTTCAATACCCCAGCCATGTACGTGGCCATTCAGGCGGTGCTGTCCTTGTATGCATCTGGGCGCACCACTGGCATTGTCATGGACTCTGGTGACGGGGT

CACACACACAGTGCCCATCTATGAGGGCTACGCCCTTCCCCACGCCATCTTGCGTCTGGACCTGGCTGGCCGGGACCTGACAGACTACCTCATGAAGATC

CTGACTGAACGGGGCTACAGCTTTACCACCACTGCTGAGAGGGAAATTGTTCGTGACATAAAGGAGAAGCTGTGCTATGTTGCCCTGGATTTTGAGCAAG

AAATGGCTACTGCTGCATCATCTTCCTCCTTGGAGAAGAGTTACGAGCTGCCCGACGGGCAGGTGATCACCATTGGCAATGAGCGGTTCCGGTGTCCGGA

GGCACTCTTCCAGCCTTCCTTCCTGG GCATGGAGTCCTGTGGTATCCATGAGACCACTTTCAACTCCATCATGAAGTGTGATGTGGATATCCGCAAAGA

CCTGTATGCCAATACAGTGCTGTCTGGTGGTACCACCATGTACCCAGGCATTGCTGACAGGATGCAGAAGGAGATCACAGCCCTAGCACCTAGCACGATG

AAGATTAAG ATCATTGCTCCCCCTGAGCGCAAGTACTCAGTCTGGATCGGTGGCTCCATTCTGGCCTCACTGTCCACCTTCCAGCAGATGTGGATCAGC

AAGCAGGAGTATGATGAG CAGGCCCCTCCATCGTCCACCGCAAATGCTTCTAGATGGACTGAGCAGGTGCCAGGCATCTGCTGCATGAGCTGA
Translation
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQVR - UNI38621 - RQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM

EKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA

GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG GMESCGIHETTF

NSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIK IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE QAPPSSTANASRW

TEQVPGICCMS
Transcript ENSMUST00000071555
Sequence
CTCACACTCCGCCGCCGGCTTACACTGCGCTTCTTGCCGCTCCTCCGTCGCCGCCGCGTCCTTCGCCG - UNI38621 - ATCGCAATGGAAGAAGAA

ATCGCCGCACTCGTCATTGACAATGGCTCCGGCATGTGCAAAGCCGGCTTTGCTGGCGACGACGCCCCCAGGGCCGTGTTCCCTTCCATCGTAGGGCGCC

CCCGACACCAG - UNI38621 - GGCGTCATGGTGGGCATGGGCCAGAAAGACTCATACGTGGGTGACGAGGCCCAGAGCAAGAGGGGTATCCTGACC

CTGAAGTACCCTATCGAACACGGCATTGTCACTAACTGGGACGACATGGAGAAGATCTGGCACCACACCTTCTACAATGAGCTGCGTGTGGCTCCTGAGG

AGCACCCGGTGCTTCTGACCGAGGCCCCCCTGAACCCCAAAGCTAACAGAGAGAAGATGACGCAG ATAATGTTTGAAACCTTCAATACCCCAGCCATGT

ACGTGGCCATTCAGGCGGTGCTGTCCTTGTATGCATCTGGGCGCACCACTGGCATTGTCATGGACTCTGGTGACGGGGTCACACACACAGTGCCCATCTA

TGAGGGCTACGCCCTTCCCCACGCCATCTTGCGTCTGGACCTGGCTGGCCGGGACCTGACAGACTACCTCATGAAGATCCTGACTGAACGGGGCTACAGC

TTTACCACCACTGCTGAGAGGGAAATTGTTCGTGACATAAAGGAGAAGCTGTGCTATGTTGCCCTGGATTTTGAGCAAGAAATGGCTACTGCTGCATCAT

CTTCCTCCTTGGAGAAGAGTTACGAGCTGCCCGACGGGCAGGTGATCACCATTGGCAATGAGCGGTTCCGGTGTCCGGAGGCACTCTTCCAGCCTTCCTT

CCTGG GCATGGAGTCCTGTGGTATCCATGAGACCACTTTCAACTCCATCATGAAGTGTGATGTGGATATCCGCAAAGACCTGTATGCCAATACAGTGCT

GTCTGGTGGTACCACCATGTACCCAGGCATTGCTGACAGGATGCAGAAGGAGATCACAGCCCTAGCACCTAGCACGATGAAGATTAAG ATCATTGCTCC

CCCTGAGCGCAAGTACTCAGTCTGGATCGGTGGCTCCATTCTGGCCTCACTGTCCACCTTCCAGCAGATGTGGATCAGCAAGCAGGAGTATGATGAGTCA

GGCCCCTCCATCGTCCACCGCAAATGCTTCTAGATGGACTGAGCAGGTGCCAGGCATCTGCTGCATGAGCTGATATTGAAGTATCAATTTGCCCTGGCAA

ATGTACACACCTCATGCTAGCCTCATGAAACTGGAATAAGCCTTTGAAAAGAAATTTGTCCTTGAAGCTTGTATCTGATATCAGCACTGGATCGTAGAAC

TTGTTGCTGATTTTTGACCTTGTATTCAAGTTAACTGCTCCCTTGGTATATGTTTAATACCCTGTGCATATCTTGATTTAGTCCTTAGTTCATGTGGCTC

GGTCACTTGGGGGCTGGGGAGAGCACGCTGTAGATGAGAAAGCCCCAGCCTGGTGGATCTCTGTGAGCACCACTGAGTGATCTGTGCAGGGTATTAACCA

ACAGCAGACTTCCAGGATTTCCTGAGGCTGGCAAGGGTTCCTGAACCAGTTACCACTCCTTCTTGCCAGTCTAACAGGGTGGGAAAGTCCGAGCCTTAGG

ACCCAGTTTCAGTTCTGGTTTCTTCCCTCCTGACCACCATCGGTTGTTAGTTGCCTTGAGTTGGGAACGTTTGCATCGACACCTGTAAATGTATTCATTC

TTTAATTTATGTAAGGTTTTTTGTACTCAATTCTTTAAGAAATGACAAATTTTGGTTTTCTACTGTTCAATGAGAACATTAGGCCCCAGCAACACGTCAT

TGTGTAAAGAAATAAAAGTGCTGCAGTAACTG
Translation
 - UNI38621 - MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ - UNI38621 - GVMVGMGQKDSYVGDEAQSKRGILTLKYPIE

HGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYAL

PHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLG GM

ESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIK IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPS

IVHRKCF
Transcript ENSMUST00000106215
Sequence
CTCACACTCCGCCGCCGGCTTACACTGCGCTTCTTGCCGCTCCTCCGTCGCCGCCGCGTCCTTCGCCG - UNI38621 - ATCGCAATGGAAGAAGAA

ATCGCCGCACTCGTCATTGACAATGGCTCCGGCATGTGCAAAGCCGGCTTTGCTGGCGACGACGCCCCCAGGGCCGTGTTCCCTTCCATCGTAGGGCGCC

CCCGACACCAG - UNI38621 - ATAATGTTTGAAACCTTCAATACCCCAGCCATGTACGTGGCCATTCAGGCGGTGCTGTCCTTGTATGCATCTGGG

CGCACCACTGGCATTGTCATGGACTCTGGTGACGGGGTCACACACACAGTGCCCATCTATGAGGGCTACGCCCTTCCCCACGCCATCTTGCGTCTGGACC

TGGCTGGCCGGGACCTGACAGACTACCTCATGAAGATCCTGACTGAACGGGGCTACAGCTTTACCACCACTGCTGAGAGGGAAATTGTTCGTGACATAAA

GGAGAAGCTGTGCTATGTTGCCCTGGATTTTGAGCAAGAAATGGCTACTGCTGCATCATCTTCCTCCTTGGAGAAGAGTTACGAGCTGCCCGACGGGCAG

GTGATCACCATTGGCAATGAGCGGTTCCGGTGTCCGGAGGCACTCTTCCAGCCTTCCTTCCTGG GCATGGAGTCCTGTGGTATCCATGAGACCACTTTC

AACTCCATCATGAAGTGTGATGTGGATATCCGCAAAGACCTGTATGCCAATACAGTGCTGTCTGGTGGTACCACCATGTACCCAGGCATTGCTGACAGGA

TGCAGAAGGAGATCACAGCCCTAGCACCTAGCACGATGAAGATTAAG ATCATTGCTCCCCCTGAGCGCAAGTACTCAGTCTGGATCGGTGGCTCCATTC

TGGCCTCACTGTCCACCTTCCAGCAGATGTGGATCAGCAAGCAGGAGTATGATGAGTCAGGCCCCTCCATCGTCCACCGCAAATGCTTCTAGATGGACTG

AGCAGGTGCCAGGCATCTGCTGCATGAGCTGATATTGAAGTATCAATTTGCCCTGGCAAATGTACACACCTCATGCTAGCCTCATGAAACTGGAATAAGC

CTTTGAAAAGAAATTTGTCCTTGAAGCTTGTATCTGATATCAGCACTGGATCGTAGAACTTGTTGCTGATTTTTGACCTTGTATTCAAGTTAACTGCTCC

CTTGGTATATGTTTAATACCCTGTGCATATCTTGATTTAGTCCTTAGTTCATGTGGCTCGGTCACTTGGGGGCTGGGGAGAGCACGCTGTAGATGAGAAA

GCCCCAGCCTGGTGGATCTCTGTGAGCACCACTGAGTGATCTGTGCAGGGTATTAACCAACAGCAGACTTCCAGGATTTCCTGAGGCTGGCAAGGGTTCC

TGAACCAGTTACCACTCCTTCTTGCCAGTCTAACAGGGTGGGAAAGTCCGAGCCTTAGGACCCAGTTTCAGTTCTGGTTTCTTCCCTCCTGACCACCATC

GGTTGTTAGTTGCCTTGAGTTGGGAACGTTTGCATCGACACCTGTAAATGTATTCATTCTTTAATTTATGTAAGGTTTTTTGTACTCAATTCTTTAAGAA

ATGACAAATTTTGGTTTTCTACTGTTCAATGAGAACATTAGGCCCCAGCAACACGTCATTGTGTAAAGAAATAAAAGTGCTGCAGTAACTG
Translation
 - UNI38621 - MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ - UNI38621 - IMFETFNTPAMYVAIQAVLSLYASGRTTGIV

MDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGN

ERFRCPEALFQPSFLG GMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIK IIAPPERKYSVWIGGSILASL

STFQQMWISKQEYDESGPSIVHRKCF
Transcript ENSMUST00000089616
Sequence
CAGATCGCAATGGAAGAAGAAATCGCCGCACTCGTCATTGACAATGGCTCCGGCATGTGCAAAGCCGGCTTTGCTGGCGACGACGCCCCCAGGGCCGTGT

TCCCTTCCATCGTAGGGCGCCCCCGACACCAG - UNI38621 - ATAATGTTTGAAACCTTCAATACCCCAGCCATGTACGTGGCCATTCAGGCGGTG

CTGTCCTTGTATGCATCTGGGCGCACCACTGGCATTGTCATGGACTCTGGTGACGGGGTCACACACACAGTGCCCATCTATGAGGGCTACGCCCTTCCCC

ACGCCATCTTGCGTCTGGACCTGGCTGGCCGGGACCTGACAGACTACCTCATGAAGATCCTGACTGAACGGGGCTACAGCTTTACCACCACTGCTGAGAG

GGAAATTGTTCGTGACATAAAGGAGAAGCTGTGCTATGTTGCCCTGGATTTTGAGCAAGAAATGGCTACTGCTGCATCATCTTCCTCCTTGGAGAAGAGT

TACGAGCTGCCCGACGGGCAGGTGATCACCATTGGCAATGAGCGGTTCCGGTGTCCGGAGGCACTCTTCCAGCCTTCCTTCCTGG GCATGGAGTCCTGT

GGTATCCATGAGACCACTTTCAACTCCATCATGAAGTGTGATGTGGATATCCGCAAAGACCTGTATGCCAATACAGTGCTGTCTGGTGGTACCACCATGT

ACCCAGGCATTGCTGACAGGATGCAGAAGGAGATCACAGCCCTAGCACCTAGCACGATGAAGATTAAG ATCATTGCTCCCCCTGAGCGCAAGTACTCAG

TCTGGATCGGTGGCTCCATTCTGGCCTCACTGTCCACCTTCCAGCAGATGTGGATCAGCAAGCAGGAGTATGATGAGTCAGGCCCCTCCATCGTCCACCG

CAAATGCTTCTAGATGGACTGAGCAGGTGCCAGGCATCTGCTGCATGAGCTGATATTGAAGTATCAATTTGCCCTGGCAAATGTACACACCTCATGCTAG

CCTCATGAAACTGGAATAAGCCTTTGAAAAGAAATTTGTCCTTGAAGCTTGTATCTGATATCAGCACTGGATCGTAGAACTTGTTGCTGATTTTTGACCT

TGTATTCAAGTTAACTGCTCCCTTGGTATATGTTTAATACCCTGTGCATATCTTGATTTAGTCCTTAGTTCATGTGGCTCGGTCACTTGGGGGCTGGGGA

GAGCACGCTGTAGATGAGAAAGCCCCAGCCTGGTGGATCTCTGTGAGCACCACTGAGTGATCTGTGCAGGGTATTAACCAACAGCAGACTTCCAGGATTT

CCTGAGGCTGGCAAGGGTTCCTGAACCAGTTACCACTCCTTCTTGCCAGTCTAACAGGGTGGGAAAGTCCGAGCCTTAGGACCCAGTTTCAGTTCTGGTT

TCTTCCCTCCTGACCACCATCGGTTGTTAGTTGCCTTGAGTTGGGAACGTTTGCATCGACACCTGTAAATGTATTCATTCTTTAATTTATGTAAGGTTTT

TTGTACTCAATTCTTTAAGAAATGACAAATTTTGGTTTTCTACTGTTCAATGAGAACATTAGGCCCCAGCAACACGTCATTGTGTAAAGAAATAAAAGTG

CTGCAGTAACTGA
Translation
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ - UNI38621 - IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIY

EGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSF

LG GMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIK IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYD

ESGPSIVHRKCF
Transcript ENSMUST00000062147
Sequence
GCTTACACTGCGCTTCTTGCCGCTCCTCCGTCGCCGCCGCGTCCTTCGCCG - UNI38621 - ATCGCAATGGAAGAAGAAATCGCCGCACTCGTCAT

TGACAATGGCTCCGGCATGTGCAAAGCCGGCTTTGCTGGCGACGACGCCCCCAGGGCCGTGTTCCCTTCCATCGTAGGGCGCCCCCGACACCAG - UNI

38621 - GGCGTCATGGTGG GCATGGAGTCCTGTGGTATCCATGAGACCACTTTCAACTCCATCATGAAGTGTGATGTGGATATCCGCAAAGACCTGT

ATGCCAATACAGTGCTGTCTGGTGGTACCACCATGTACCCAGGCATTGCTGACAGGATGCAGAAGGAGATCACAGCCCTAGCACCTAGCACGATGAAGAT

TAAG ATCATTGCTCCCCCTGAGCGCAAGTACTCAGTCTGGATCGGTGGCTCCATTCTGGCCTCACTGTCCACCTTCCAGCAGATGTGGATCAGCAAGCA

GGAGTATGATGAGTCAGGCCCCTCCATCGTCCACCGCAAATGCTTCTAGATGGACTGAGCAGGTGCCAGGCATCTGCTGCATGAGCTGATATTGAAGTAT

CAATTTGCCCTGGCAAATGTACACACCTCATGCTAGCCTCATGAAACTGGAATAAGCCTTTGAAAAGAAATTTGTCCTTGAAGCTTGTATCTGATATCAG

CACTGGATCGTAGAACTTGTTGCTGATTTTTGACCTTGTATTCAAGTTAACTGCTCCCTTGGTATATGTTTAATACCCTGTGCATATCTTGATTTAGTCC

TTAGTTCATGTGGCTCGGTCACTTGGGGGCTGGGGAGAGCACGCTGTAGATGAGAAAGCCCCAGCCTGGTGGATCTCTGTGAGCACCACTGAGTGATCTG

TGCAGGGTATTAACCAACAGCAGACTTCCAGGATTTCCTGAGGCTGGCAAGGGTTCCTGAACCAGTTACCACTCCTTCTTGCCAGTCTAACAGGGTGGGA

AAGTCCGAGCCTTAGGACCCAGTTTCAGTTCTGGTTTCTTCCCTCCTGACCACCATCGGTTGTTAGTTGCCTTGAGTTGGGAACGTTTGCATCGACACCT

GTAAATGTATTCATTCTTTAATTTATGTAAGGTTTTTTGTACTCAATTCTTTAAGAAATGACAAATTTTGGTTTTCTACTGTTCAATGAGAACATTAGGC

CCCAGCAACACGTCATTGTGTAAAGAAATAAAAGTGCTGCAGTAACTGA
Translation
 - UNI38621 - MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ - UNI38621 - GVMVG GMESCGIHETTFNSIMKCDVDIRKD

LYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIK IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF

For any suggestions or comments, please send an email to unitrap@crg.es