Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000062949 (Atp11c)
Chromosomal location
Chr X: 57476470 - 57657156 (-)
Description
ATPase, class VI, type 11C Gene [Source:MGI Symbol;Acc:MGI:1859661]
RefSeq_dna
NM_001037863 NM_001001798 
RefSeq_peptide
NP_001032952.1 NP_001001798.1 
UniGene
Mm.327798 Mm.403777 Mm.476285 
MGI
MGI:1859661 
Uniprot/SWISSPROT
Q9QZW0 
Uniprot/SPTREMBL
B1AUG5 
Human Ortholog
ENSG00000101974 (ATP11C)
Omim not available
UniTrap UNI6913
Vector Insertion
Chr X: 57574731 - 57656979
Public Clones RRM203 (baygenomics) RRX137 (baygenomics) IST14096B3 (tigm) IST10252E2 (tigm)
IST14329D6 (tigm) IST14639G2 (tigm) IST11922E4 (tigm)
Private Clones OST33486 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3940
Vector Insertion
Chr X: 57562983 - 57574610
Public Clones AS0652 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33383
Vector Insertion
Chr X: 57519912 - 57523175
Public Clones IST11301B3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000101527
Sequence
AGGAGGGCAGGCGGCAGCGGGCTGGCGACAGGGCAGGCGAGCTAGCTGTCCGCTTTGCGCCGCGGGCCCACGCCGCAGTGTGTTTTGTGGACGGCGCCTT

CCCAGACAGCCCAGCGGAGCCCAGCCTGGCACCCCGCAGCCTCGGACGCGATGTTCCGCCGGACCCTCAACCGTTTG - UNI6913 - TGTGCTGGAG

AAGAGAAACGAGTTGGTACACGCACAGTGTTTGTTGGCAATCATCCCATTTCTGGAACAGAACCTTATATTGCGCAAAGATTTTGTGATAATAGAATAGT

CTCATCTAAG - UNI3940 - TATACACTTTGGAATTTCCTCCCTAAGAATTTGTTTGAACAGTTTAGAAGAATTGCGAATTTTTATTTCCTCATCAT

TTTCCTTGTACAG GTCACAGTAGACACACCAACCAGCCCAGTTACCAGTGGACTTCCACTTTTTTTCGTTATAACTGTTACAGCAATCAAGCAG GGGT

ATGAAGATTGGCTTAGACACAGAGCTGATAATGAAGTTAACAAAAGTGCTGTTTATATTATTGAAAATGCAAAGCGAGTGAGGAAAGAAAGTGAAAAAAT

CAAG GTTGGTGATGTAGTAGAAGTACAGGCAAATGAAACCTTTCCCTGTGATCTTATACTTCTGTCATCCTGCACAACTGATGGAACCTGTTATGTCAC

TACAGCCAGTCTTGATGGTGAATCTAATTGCAAG ACACATTATGCAGTACGAGATACCATTGCACTGTGTACAGCCGAATCCATTGATAATCTCCGAGC

AACAATTGAATGTGAGCAGCCTCAACCTGATCTCTACAG GTTTGTTGGGCGAATCAGTATCTATAGTAATAGTATTGAGGCTGTTGCCAG GTCTTTGG

GACCTGAAAATCTTTTGCTGAAAGGAGCCACACTTAAAAATACCAAGAAGATATATG GAGTTGCTGTTTACACTGGGATGGAAACCAAAATGGCTTTGA

ACTACCAAGGGAAATCTCAGAAATGTTCTGCTGTTGAAAA ATCTATTAATGCCTTCTTGATTGTTTATTTATTTATCTTACTGACCAAAGCTGCAGTAT

GCACAACTCTTAAGTATGTTTGGCAAAGTTCCCCATACAATGATGAACCATGGTATAACCAAAAGACTCAAAAGGAACGGGAAACTTTTCAG GTTTTGA

AAATGTTCACTGACTTTTTATCATTCATGGTTCTTTTCAACTTCATTATACCTGTCTCCATGTATGTCACAGTAGAAATGCAGAAATTTTTAGGGTCATT

CTTTATTTCATGGGATAAAGACTTTTTTGATGAAGAAATTAATGAAGGAGCCTTGGTTAATACATCAGACCTTAATGAAGAACTTGGTCAG GTGGACTA

TGTATTTACAGATAAGACTGGGACACTCACTGAAAATAGCATGGAATTCATTGAATGCTGCATAGATGGGCACAAATATAAAGGCACAACTCAGGAAGTT

GATGGATTATCTCAGACTGATGGGCCCTTAGCCTATTTTGATAAAGCAGATAAG AACCGAGAGGCACTCTTTCTCCGTGCCCTATGCTTATGTCACACT

GTAGAAATGAAAACAAATGATGATGTTGATGGACCTGTAGAAGGAGCCGGATTCACATATATCTCCTCCTCACCAGATGAAATAGCTTTGGTGAAAGGAG

CTAAAAG GTTTGGGTTCACATTTTTGGGAAATCAGAATGGATATATCAGAGTAGAGAACCAAAGAAAAGAAATAGAAGA GTATGAACTTCTCCACACC

TTAAATTTTGATTCTGTCCGCCGACGTATGAGTGTAATTGTAAGGACCCAAAAAG GAGATATTCTACTTTTCTGTAAAGGAGCAGATTCATCAATTTTT

CCCAGGGTACATAGCCATCAAATTGAGTTAACCAAAGACCATGTGGAACGTAATGCAATG GATGGGTATCGGACTCTTTGTGTAGCCTTCAAAGAAATT

CCTCCAGATGATTTTGAAAGAATCAATGCACAACTAGTAGAGGCAAAAATGGCCCTACAAGATAGAGAAGAAAAACTGGAAAAGGTTTTTGATGAGATTG

AGACTAACATGAATTTAATTGGAGCCACTGCTGTGGAAGACAA - UNI33383 - GCTGCAAGATCAGGCTGCAGAGACCATTGAAGCTCTCCATGCA

GCTGGCTTAAAAGTCTGGGTGCTTACTGGGGACAAGATGGAAACAGCCAAATCTACTTGCTATGCCTGCCGCCTTTTCCAAACCAATACTGAGCTCTTGG

AACTGACCACAAAAACCATTGAAGAGAGTGAAAGGAAAGAAGATCGATTACATGAACTGCTAATAGAATATCGTAAGAAGTTGCTGCATGAATTTCCTAA

AAGCACTAGAAGCCTTAAAAA - UNI33383 - AGCATGGACAGAACATCAGGAATATGGATTAATCATTGATGGCTCCACATTGTCACTCATACTAA

ATTCTAGTCAAGATTGTAGTTCAAACAACTATAAAAGTATTTTTCTACAAATCTGTATGAAATGCACTGCAGTGCTCTGCTGCCGGATGGCACCATTACA

AAAAGCCCAG - UNI33383 - ATTGTCAGAATGGTGAAGAACTTGAAAGGCAGCCCCATAACACTGTCAATAGGTGATGGTGCCAATGATGTCAGTA

TGATTTTGGAATCCCATGTGGGAATAG GTATTAAAGGAAAAGAAGGCCGTCAAGCAGCCAGGAATAGTGATTATTCTGTTCCAAAGTTTAAGCATTTAA

AGAAACTGCTATTGGTTCATGGACATCTATACTATGTGAGAATAGCACATCTTGTACAATATTTCTTCTACAAG AACCTTTGTTTCATTTTGCCACAAT

TTTTGTACCAGTTCTTCTGTGGATTCTCACAACAG CCACTCTATGATGCTGCTTATCTTACAATGTACAATATCTGTTTCACATCCCTGCCCATCCTGG

CTTATAGTCTACTGGAACAGCACATCAACATTGATACTCTGACCGCAGACCCTCGATTGTATAT GAAAATTACCGGTAATGCTATGTTACAGTTGGGGC

CCTTCTTACATTGGACATTTCTGGCTGCATTTGAAGGGACAGTATTCTTCTTTGGGACTTATTTCCTTTTTCAGACTTCATCCTTAGAAGACAATGGAAA

G ATTTATGGAAATTGGACATTTGGAACCATTGTTTTTACAGTCTTAGTATTCACCGTAACTCTGAAG CTCGCCTTGGATACCCGGTTCTGGACATGGA

TAAATCATTTTGTGATTTGGGGTTCTCTAGCCTTTTATGTTTTTTTCTCATTCTTCTGGGGAGGAATTATTTG GCCTTTTCTGAAACAACAGAGAATGT

ATTTTGTGTTTGCTCAAATGCTCTGTTCTGTATCCACATGGTTGGCTATAATCCTTTTAATATTTATCAGCCTTTTCCCTGAGATTCTCCTAATAGTTGT

AAAGAATGTTCGAAGAAGAAGTGCCAGG AGAAATCTGAGCTGTAGAAGGGCATCTGACTCATTATCCGCCAGACCTTCAGTCAGACCTCTTCTTTTACG

AACATTCTCAGACGAATCTAATATATTGTAACAG AATCCGAATCTTGAACTGCCTATGTTATTGTCCTACAAGCATATTGACCGTGGTTGCAGCTAAAG

AGAGAAAGCATGAAGGAACAACTACAAAAGATATTAACTCAGGATACTCAATATGAAACAAAGACCACTCTCATGTGTAGGGTTCACAATAAATGTTCAT

TAAAGTACCAAATAACTCTCTTAACCATTTACAGTTATTGTAAGTAGCCATTATGGCCCAAGTGAGAATTAGATGAAAGTTTAAAGTAAGCATACTTAGC

ATTCTGGATTTAGATAGACTAATGTAACTACAAAATGGGTGCTCTTTTAACCCGCTGACTTTGTGAATGGATTTCAATAATAGTATAAAGTAGAAGGCAT

GCAATGGGGATGAGCAGGTTTGGCTAACCAGTGTTTCCTTCCGCCTGGCAGAAGTCGTAGACTGCTTGTCTCACCTCTCTCATTCCTGCTCAATGATTAT

CTTTTTTCCCACACACAAAAGGAATACTTGAAAATACAAGACTAAATGATATTACTGCATCAGACAAAATACATCATCATCTTTTCAGTCATAGGCTAAT

TGTCTTGGTCTAATATCCTTTCCAAAAAGTACCTTGCATACTTGTGTGATACTGTTAATTCTGGGTATTATTGTAGAAACAAGGGTGGAAAGGTTATTTG

GTGTGTTTTCTTCTGAATTACACACCACTTATGTATTTAAGACTACTAAACTTGAAAATACAATATTTCAGTCTCTTGGTAGTAGCCCCTCAAAACAGTT

AAGTAGAAAGATTTCCATCCAATGTTAGTTTTGCTGGGTAACGTGGTAAGGTGTGTTAAATATTTACATAAAAATGAATGCCATTCTTAACACTGGCATT

TTATAATTCTATGTGGCAAAGATGGGAAGAATAGCCTATTTTCAACTACTAACGGTTTTTATTTGAAAGAGAGTGTTTTTGTGCATATTTACAGCACTTT

TTTTTTAAAAAAAGTTACCAATTTGGAAAGAGGAGATCTATTCCAAAGCCCTGTAGAGCCACAACTCTTTGGACATGAATGTTGGTTCCTATAGCTAAGT

GGGCCAAGGAAATGGTCTATTTCTAAATTATGTGATGGACCTTGGTAAGATCCTCAAACTGCTGGACCAGAAAGAGGTTTTAGCCCCTAATACGTTCTCT

TAAAACATGAAAGAAGTATGAAATGTCTTTACTTGAAAGAAGGACCACGTTTGACAGATAGGCTAAAATGATATTTAGAAAATATTTTTCTATCAGTTTC

CATTTTTTTGTCTGACATGCCTGTACTATTTAATGTTTATATTGTACTTTGATTTAAGAACATACTAGACTCATTGTCTTCCAGTATATTTATATGTCCA

TATGGCACATTTTGATTCTTCCATGTATTTGTGTGGATGTTTATTTGGGTGTATTTTTTCTTAAATTCTAAAAAGGCCATAATTTCAGTTATCAGAAATT

ATTCCATAATTACTTAATTTAATTTGTTCTCATCTATCAGTATTACTTTTGAGTATTTTGTTAGGTGTCAATCACAGCTTAAGTGTGTGCTCTTGTAGCC

TGTATTTGAGGAAATCTGCTGAAAGCAAAGTCTTTCTATTCTTTGCCTATTCCAAAGAGCTAAAACATCTAACCCAGGAAAGCTTTGCTGCTTTGTTATT

GTTGTCATTGTTGTTGCTGCTGTATTATTATTTTACATCAGAACTGTAAGGACTGTGAATAAATATAAGAGCCAAGTAGAGAGGCTTAGTTAATGCAGAA

TGATTGAGGAGATGATAAAATCAAAATATTTAAGGTAGTAGAAATAAAACTGATTATGTATGACTTGTTGCAGCAGAAAGAAATCTAGATGAACAAATGA

GAATTTAGAGTCATGCCTCAGTTAACCATTACATTGTACACTGCACTTCAAATCAGAGGAACCTGGGTTTGCTTTTTGAAAAATTTTTATTAGTGATCTA

AAACATGGCTAGCATGGGCTTAGCAGATGAAGTTATTTGAAATGAGCCATCCGATATTCCTAGCACTATATTTTAACTATTCTTATTTCAGAAGAGGGCA

AGAAATCTAACAGTAGGTCCATATTGCCATAATTTTAATAATAATTTTTGAGCTATCAAAATGTCTATGTAATTTTCCAAATTGTTGTCTATTGTTTGAA

GGTGTTGCCTATTAAACAAAAAATATCCATTCCATATCTACTACATATACACCAGCAACAGTATAAATGTAAGCCTAAATTTGCAAAAGTCATAATTTAG

TGATGGAATTTTTTAATAACATGCAGTATATAAATGTGCAGATTTTATGCAAGTGTTGATAAAAATCATTTTTCAGCTTGTAAAATGGGACTGCAATATT

ACATTTTTCACTTAAGCAGTTTTTTACATCTACTTTGTTGCTTTCTAAAATGACATGAATGCCATCTTTTATGAATGCAACTTGCCTTTTTCGTTACAGA

AACTTTCATTTGATGTAATCAATAAACTTTGGTATG
Translation
MFRRTLNRL - UNI6913 - CAGEEKRVGTRTVFVGNHPISGTEPYIAQRFCDNRIVSSK - UNI3940 - YTLWNFLPKNLFEQFRRIANFYFLI

IFLVQ VTVDTPTSPVTSGLPLFFVITVTAIKQ GYEDWLRHRADNEVNKSAVYIIENAKRVRKESEKIK VGDVVEVQANETFPCDLILLSSCTTDGTC

YVTTASLDGESNCK THYAVRDTIALCTAESIDNLRATIECEQPQPDLYR RFVGRISIYSNSIEAVAR RSLGPENLLLKGATLKNTKKIYG GVAVYT

GMETKMALNYQGKSQKCSAVEK KSINAFLIVYLFILLTKAAVCTTLKYVWQSSPYNDEPWYNQKTQKERETFQ VLKMFTDFLSFMVLFNFIIPVSMYV

TVEMQKFLGSFFISWDKDFFDEEINEGALVNTSDLNEELGQ VDYVFTDKTGTLTENSMEFIECCIDGHKYKGTTQEVDGLSQTDGPLAYFDKADK NRE

ALFLRALCLCHTVEMKTNDDVDGPVEGAGFTYISSSPDEIALVKGAKR RFGFTFLGNQNGYIRVENQRKEIEE EYELLHTLNFDSVRRRMSVIVRTQK

G GDILLFCKGADSSIFPRVHSHQIELTKDHVERNAM DGYRTLCVAFKEIPPDDFERINAQLVEAKMALQDREEKLEKVFDEIETNMNLIGATAVEDK 

- UNI33383 - KLQDQAAETIEALHAAGLKVWVLTGDKMETAKSTCYACRLFQTNTELLELTTKTIEESERKEDRLHELLIEYRKKLLHEFPKSTRSL

KK - UNI33383 - KAWTEHQEYGLIIDGSTLSLILNSSQDCSSNNYKSIFLQICMKCTAVLCCRMAPLQKAQ - UNI33383 - IVRMVKNLKGS

PITLSIGDGANDVSMILESHVGIG GIKGKEGRQAARNSDYSVPKFKHLKKLLLVHGHLYYVRIAHLVQYFFYK NLCFILPQFLYQFFCGFSQQ PLYD

AAYLTMYNICFTSLPILAYSLLEQHINIDTLTADPRLYM MKITGNAMLQLGPFLHWTFLAAFEGTVFFFGTYFLFQTSSLEDNGK IYGNWTFGTIVFT

VLVFTVTLK LALDTRFWTWINHFVIWGSLAFYVFFSFFWGGIIW WPFLKQQRMYFVFAQMLCSVSTWLAIILLIFISLFPEILLIVVKNVRRRSAR R

NLSCRRASDSLSARPSVRPLLLRTFSDESNIL 
Transcript ENSMUST00000033480
Sequence
AGGAGGGCAGGCGGCAGCGGGCTGGCGACAGGGCAGGCGAGCTAGCTGTCCGCTTTGCGCCGCGGGCCCACGCCGCAGTGTGTTTTGTGGACGGCGCCTT

CCCAGACAGCCCAGCGGAGCCCAGCCTGGCACCCCGCAGCCTCGGACGCGATGTTCCGCCGGACCCTCAACCGTTTG - UNI6913 - TGTGCTGGAG

AAGAGAAACGAGTTGGTACACGCACAGTGTTTGTTGGCAATCATCCCATTTCTGGAACAGAACCTTATATTGCGCAAAGATTTTGTGATAATAGAATAGT

CTCATCTAAG - UNI3940 - TATACACTTTGGAATTTCCTCCCTAAGAATTTGTTTGAACAGTTTAGAAGAATTGCGAATTTTTATTTCCTCATCAT

TTTCCTTGTACAG GTCACAGTAGACACACCAACCAGCCCAGTTACCAGTGGACTTCCACTTTTTTTCGTTATAACTGTTACAGCAATCAAGCAG GGGT

ATGAAGATTGGCTTAGACACAGAGCTGATAATGAAGTTAACAAAAGTGCTGTTTATATTATTGAAAATGCAAAGCGAGTGAGGAAAGAAAGTGAAAAAAT

CAAG GTTGGTGATGTAGTAGAAGTACAGGCAAATGAAACCTTTCCCTGTGATCTTATACTTCTGTCATCCTGCACAACTGATGGAACCTGTTATGTCAC

TACAGCCAGTCTTGATGGTGAATCTAATTGCAAG ACACATTATGCAGTACGAGATACCATTGCACTGTGTACAGCCGAATCCATTGATAATCTCCGAGC

AACAATTGAATGTGAGCAGCCTCAACCTGATCTCTACAG GTTTGTTGGGCGAATCAGTATCTATAGTAATAGTATTGAGGCTGTTGCCAG GTCTTTGG

GACCTGAAAATCTTTTGCTGAAAGGAGCCACACTTAAAAATACCAAGAAGATATATG GAGTTGCTGTTTACACTGGGATGGAAACCAAAATGGCTTTGA

ACTACCAAGGGAAATCTCAGAAATGTTCTGCTGTTGAAAA ATCTATTAATGCCTTCTTGATTGTTTATTTATTTATCTTACTGACCAAAGCTGCAGTAT

GCACAACTCTTAAGTATGTTTGGCAAAGTTCCCCATACAATGATGAACCATGGTATAACCAAAAGACTCAAAAGGAACGGGAAACTTTTCAG GTTTTGA

AAATGTTCACTGACTTTTTATCATTCATGGTTCTTTTCAACTTCATTATACCTGTCTCCATGTATGTCACAGTAGAAATGCAGAAATTTTTAGGGTCATT

CTTTATTTCATGGGATAAAGACTTTTTTGATGAAGAAATTAATGAAGGAGCCTTGGTTAATACATCAGACCTTAATGAAGAACTTGGTCAG GTGGACTA

TGTATTTACAGATAAGACTGGGACACTCACTGAAAATAGCATGGAATTCATTGAATGCTGCATAGATGGGCACAAATATAAAGGCACAACTCAGGAAGTT

GATGGATTATCTCAGACTGATGGGCCCTTAGCCTATTTTGATAAAGCAGATAAG AACCGAGAGGCACTCTTTCTCCGTGCCCTATGCTTATGTCACACT

GTAGAAATGAAAACAAATGATGATGTTGATGGACCTGTAGAAGGAGCCGGATTCACATATATCTCCTCCTCACCAGATGAAATAGCTTTGGTGAAAGGAG

CTAAAAG GTTTGGGTTCACATTTTTGGGAAATCAGAATGGATATATCAGAGTAGAGAACCAAAGAAAAGAAATAGAAGA GTATGAACTTCTCCACACC

TTAAATTTTGATTCTGTCCGCCGACGTATGAGTGTAATTGTAAGGACCCAAAAAG GAGATATTCTACTTTTCTGTAAAGGAGCAGATTCATCAATTTTT

CCCAGGGTACATAGCCATCAAATTGAGTTAACCAAAGACCATGTGGAACGTAATGCAATG GATGGGTATCGGACTCTTTGTGTAGCCTTCAAAGAAATT

CCTCCAGATGATTTTGAAAGAATCAATGCACAACTAGTAGAGGCAAAAATGGCCCTACAAGATAGAGAAGAAAAACTGGAAAAGGTTTTTGATGAGATTG

AGACTAACATGAATTTAATTGGAGCCACTGCTGTGGAAGACAA - UNI33383 - GCTGCAAGATCAGGCTGCAGAGACCATTGAAGCTCTCCATGCA

GCTGGCTTAAAAGTCTGGGTGCTTACTGGGGACAAGATGGAAACAGCCAAATCTACTTGCTATGCCTGCCGCCTTTTCCAAACCAATACTGAGCTCTTGG

AACTGACCACAAAAACCATTGAAGAGAGTGAAAGGAAAGAAGATCGATTACATGAACTGCTAATAGAATATCGTAAGAAGTTGCTGCATGAATTTCCTAA

AAGCACTAGAAGCCTTAAAAA - UNI33383 - AGCATGGACAGAACATCAGGAATATGGATTAATCATTGATGGCTCCACATTGTCACTCATACTAA

ATTCTAGTCAAGATTGTAGTTCAAACAACTATAAAAGTATTTTTCTACAAATCTGTATGAAATGCACTGCAGTGCTCTGCTGCCGGATGGCACCATTACA

AAAAGCCCAG - UNI33383 - ATTGTCAGAATGGTGAAGAACTTGAAAGGCAGCCCCATAACACTGTCAATAGGTGATGGTGCCAATGATGTCAGTA

TGATTTTGGAATCCCATGTGGGAATAG GTATTAAAGGAAAAGAAGGCCGTCAAGCAGCCAGGAATAGTGATTATTCTGTTCCAAAGTTTAAGCATTTAA

AGAAACTGCTATTGGTTCATGGACATCTATACTATGTGAGAATAGCACATCTTGTACAATATTTCTTCTACAAG AACCTTTGTTTCATTTTGCCACAAT

TTTTGTACCAGTTCTTCTGTGGATTCTCACAACAG CCACTCTATGATGCTGCTTATCTTACAATGTACAATATCTGTTTCACATCCCTGCCCATCCTGG

CTTATAGTCTACTGGAACAGCACATCAACATTGATACTCTGACCGCAGACCCTCGATTGTATAT GAAAATTACCGGTAATGCTATGTTACAGTTGGGGC

CCTTCTTACATTGGACATTTCTGGCTGCATTTGAAGGGACAGTATTCTTCTTTGGGACTTATTTCCTTTTTCAGACTTCATCCTTAGAAGACAATGGAAA

G ATTTATGGAAATTGGACATTTGGAACCATTGTTTTTACAGTCTTAGTATTCACCGTAACTCTGAAG CTCGCCTTGGATACCCGGTTCTGGACATGGA

TAAATCATTTTGTGATTTGGGGTTCTCTAGCCTTTTATGTTTTTTTCTCATTCTTCTGGGGAGGAATTATTTG GCCTTTTCTGAAACAACAGAGAATGT

ATTTTGTGTTTGCTCAAATGCTCTGTTCTGTATCCACATGGTTGGCTATAATCCTTTTAATATTTATCAGCCTTTTCCCTGAGATTCTCCTAATAGTTGT

AAAGAATGTTCGAAGAAGAAGTGCCAGG AATCCGAATCTTGAACTGCCTATGTTATTGTCCTACAAGCATATTGACCGTGGTTGCAGCTAAAGAGAGAA

AGCATGAAGGAACAACTACAAAAGATATTAACTCAGGATACTCAATATGAAACAAAGACCACTCTCATGTGTAGGGTTCACAATAAATGTTCATTAAAGT

ACCAAATAACTCTCTTAACCATTTACAGTTATTGTAAGTAGCCATTATGGCCCAAGTGAGAATTAGATGAAAGTTTAAAGTAAGCATACTTAGCATTCTG

GATTTAGATAGACTAATGTAACTACAAAATGGGTGCTCTTTTAACCCGCTGACTTTGTGAATGGATTTCAATAATAGTATAAAGTAGAAGGCATGCAATG

GGGATGAGCAGGTTTGGCTAACCAGTGTTTCCTTCCGCCTGGCAGAAGTCGTAGACTGCTTGTCTCACCTCTCTCATTCCTGCTCAATGATTATCTTTTT

TCCCACACACAAAAGGAATACTTGAAAATACAAGACTAAATGATATTACTGCATCAGACAAAATACATCATCATCTTTTCAGTCATAGGCTAATTGTCTT

GGTCTAATATCCTTTCCAAAAAGTACCTTGCATACTTGTGTGATACTGTTAATTCTGGGTATTATTGTAGAAACAAGGGTGGAAAGGTTATTTGGTGTGT

TTTCTTCTGAATTACACACCACTTATGTATTTAAGACTACTAAACTTGAAAATACAATATTTCAGTCTCTTGGTAGTAGCCCCTCAAAACAGTTAAGTAG

AAAGATTTCCATCCAATGTTAGTTTTGCTGGGTAACGTGGTAAGGTGTGTTAAATATTTACATAAAAATGAATGCCATTCTTAACACTGGCATTTTATAA

TTCTATGTGGCAAAGATGGGAAGAATAGCCTATTTTCAACTACTAACGGTTTTTATTTGAAAGAGAGTGTTTTTGTGCATATTTACAGCACTTTTTTTTT

AAAAAAAGTTACCAATTTGGAAAGAGGAGATCTATTCCAAAGCCCTGTAGAGCCACAACTCTTTGGACATGAATGTTGGTTCCTATAGCTAAGTGGGCCA

AGGAAATGGTCTATTTCTAAATTATGTGATGGACCTTGGTAAGATCCTCAAACTGCTGGACCAGAAAGAGGTTTTAGCCCCTAATACGTTCTCTTAAAAC

ATGAAAGAAGTATGAAATGTCTTTACTTGAAAGAAGGACCACGTTTGACAGATAGGCTAAAATGATATTTAGAAAATATTTTTCTATCAGTTTCCATTTT

TTTGTCTGACATGCCTGTACTATTTAATGTTTATATTGTACTTTGATTTAAGAACATACTAGACTCATTGTCTTCCAGTATATTTATATGTCCATATGGC

ACATTTTGATTCTTCCATGTATTTGTGTGGATGTTTATTTGGGTGTATTTTTTCTTAAATTCTAAAAAGGCCATAATTTCAGTTATCAGAAATTATTCCA

TAATTACTTAATTTAATTTGTTCTCATCTATCAGTATTACTTTTGAGTATTTTGTTAGGTGTCAATCACAGCTTAAGTGTGTGCTCTTGTAGCCTGTATT

TGAGGAAATCTGCTGAAAGCAAAGTCTTTCTATTCTTTGCCTATTCCAAAGAGCTAAAACATCTAACCCAGGAAAGCTTTGCTGCTTTGTTATTGTTGTC

ATTGTTGTTGCTGCTGTATTATTATTTTACATCAGAACTGTAAGGACTGTGAATAAATATAAGAGCCAAGTAGAGAGGCTTAGTTAATGCAGAATGATTG

AGGAGATGATAAAATCAAAATATTTAAGGTAGTAGAAATAAAACTGATTATGTATGACTTGTTGCAGCAGAAAGAAATCTAGATGAACAAATGAGAATTT

AGAGTCATGCCTCAGTTAACCATTACATTGTACACTGCACTTCAAATCAGAGGAACCTGGGTTTGCTTTTTGAAAAATTTTTATTAGTGATCTAAAACAT

GGCTAGCATGGGCTTAGCAGATGAAGTTATTTGAAATGAGCCATCCGATATTCCTAGCACTATATTTTAACTATTCTTATTTCAGAAGAGGGCAAGAAAT

CTAACAGTAGGTCCATATTGCCATAATTTTAATAATAATTTTTGAGCTATCAAAATGTCTATGTAATTTTCCAAATTGTTGTCTATTGTTTGAAGGTGTT

GCCTATTAAACAAAAAATATCCATTCCATATCTACTACATATACACCAGCAACAGTATAAATGTAAGCCTAAATTTGCAAAAGTCATAATTTAGTGATGG

AATTTTTTAATAACATGCAGTATATAAATGTGCAGATTTTATGCAAGTGTTGATAAAAATCATTTTTCAGCTTGTAAAATGGGACTGCAATATTACATTT

TTCACTTAAGCAGTTTTTTACATCTACTTTGTTGCTTTCTAAAATGACATGAATGCCATCTTTTATGAATGCAACTTGCCTTTTTCGTTACAGAAACTTT

CATTTGATGTAATCAATAAACTTTGGTATG
Translation
MFRRTLNRL - UNI6913 - CAGEEKRVGTRTVFVGNHPISGTEPYIAQRFCDNRIVSSK - UNI3940 - YTLWNFLPKNLFEQFRRIANFYFLI

IFLVQ VTVDTPTSPVTSGLPLFFVITVTAIKQ GYEDWLRHRADNEVNKSAVYIIENAKRVRKESEKIK VGDVVEVQANETFPCDLILLSSCTTDGTC

YVTTASLDGESNCK THYAVRDTIALCTAESIDNLRATIECEQPQPDLYR RFVGRISIYSNSIEAVAR RSLGPENLLLKGATLKNTKKIYG GVAVYT

GMETKMALNYQGKSQKCSAVEK KSINAFLIVYLFILLTKAAVCTTLKYVWQSSPYNDEPWYNQKTQKERETFQ VLKMFTDFLSFMVLFNFIIPVSMYV

TVEMQKFLGSFFISWDKDFFDEEINEGALVNTSDLNEELGQ VDYVFTDKTGTLTENSMEFIECCIDGHKYKGTTQEVDGLSQTDGPLAYFDKADK NRE

ALFLRALCLCHTVEMKTNDDVDGPVEGAGFTYISSSPDEIALVKGAKR RFGFTFLGNQNGYIRVENQRKEIEE EYELLHTLNFDSVRRRMSVIVRTQK

G GDILLFCKGADSSIFPRVHSHQIELTKDHVERNAM DGYRTLCVAFKEIPPDDFERINAQLVEAKMALQDREEKLEKVFDEIETNMNLIGATAVEDK 

- UNI33383 - KLQDQAAETIEALHAAGLKVWVLTGDKMETAKSTCYACRLFQTNTELLELTTKTIEESERKEDRLHELLIEYRKKLLHEFPKSTRSL

KK - UNI33383 - KAWTEHQEYGLIIDGSTLSLILNSSQDCSSNNYKSIFLQICMKCTAVLCCRMAPLQKAQ - UNI33383 - IVRMVKNLKGS

PITLSIGDGANDVSMILESHVGIG GIKGKEGRQAARNSDYSVPKFKHLKKLLLVHGHLYYVRIAHLVQYFFYK NLCFILPQFLYQFFCGFSQQ PLYD

AAYLTMYNICFTSLPILAYSLLEQHINIDTLTADPRLYM MKITGNAMLQLGPFLHWTFLAAFEGTVFFFGTYFLFQTSSLEDNGK IYGNWTFGTIVFT

VLVFTVTLK LALDTRFWTWINHFVIWGSLAFYVFFSFFWGGIIW WPFLKQQRMYFVFAQMLCSVSTWLAIILLIFISLFPEILLIVVKNVRRRSAR N

PNLELPMLLSYKHIDRGCS

For any suggestions or comments, please send an email to unitrap@crg.es