Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000062963 (Ufc1)
Chromosomal location
Chr 1: 173218694 - 173225155 (-)
Description
ubiquitin-fold modifier conjugating enzyme 1 Gene [Source:MGI (curated);Acc:Ufc1-001]
RefSeq_dna
NM_025388 
RefSeq_peptide
NP_079664.1 
MGI
MGI:1913405 
Uniprot/SWISSPROT
Q9CR09 
Human Ortholog
ENSG00000143222 (UFC1)
Omim not available
UniTrap UNI14254
Vector Insertion
Chr 1: 173224764 - 173225156
Public Clones FHCRC-GT-S21-8E1 (fhcrc) IST12922A9 (tigm) IST12778F11 (tigm) IST14151F9 (tigm)
Private Clones OST66605 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18370
Vector Insertion
Chr 1: 173224764 - 173224912
Public Clones not available
Private Clones OST424730 (lexicon) OST401871 (lexicon) OST401449 (lexicon) OST388272 (lexicon)
OST316328 (lexicon) OST246020 (lexicon) OST239871 (lexicon) OST200127 (lexicon)
OST199698 (lexicon) OST190075 (lexicon) OST176695 (lexicon) OST175245 (lexicon)
OST118027 (lexicon) OST110828 (lexicon) OST110820 (lexicon) OST109166 (lexicon)
OST100891 (lexicon) OST51300 (lexicon) OST44849 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16872
Vector Insertion
Chr 1: 173220348 - 173224764
Public Clones (sanger) PST23350-NR (escells) PST17984-NR (escells) IST11450A9 (tigm)
IST14464H9 (tigm) IST14336B10 (tigm) IST12238G7 (tigm) IST14663F9 (tigm)
IST11384G9 (tigm) IST12059C10 (tigm) IST15076A7 (tigm) IST12298D11 (tigm)
IST11189G7 (tigm)
Private Clones OST452977 (lexicon) OST348098 (lexicon) OST339639 (lexicon) OST280381 (lexicon)
OST263218 (lexicon) OST183158 (lexicon) OST178045 (lexicon)
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19456
Vector Insertion
Chr 1: 173220079 - 173220279
Public Clones not available
Private Clones OST390901 (lexicon) OST301722 (lexicon) OST273586 (lexicon) OST213403 (lexicon)
OST169009 (lexicon) OST109072 (lexicon)
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21700
Vector Insertion
Chr 1: 173219726 - 173220014
Public Clones not available
Private Clones OST320612 (lexicon)
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23683
Vector Insertion
Chr 1: 173219393 - 173219648
Public Clones not available
Private Clones OST249276 (lexicon)
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23643
Vector Insertion
Chr 1: 173219103 - 173219301
Public Clones CMHD-GT_431H8-3 (cmhd)
Private Clones OST250828 (lexicon) OST224885 (lexicon) OST18530 (lexicon)
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111302
Sequence
AGTTTTCCTGCTCCCTGGTCCAAGATGGCGGACGAGGCCACTCGGCGGGTCGTGTCTGAGATCCCGGTGCTGAAGACCAACGCCGGACCCCGAGATCGGG

AATTGTGGGTGCAGCGACTAAAGGAGGAATATCAGTCCCTGATCCGG - UNI14254 - - UNI16872 - - UNI18370 - TATGTGGAGAACA

ACAAGAATTCGGACAATGATTGGTTCCGACTGGAGTCCAACAAGGAAGGGACCCG - UNI19456 - GTGGTTTGGAAAATGCTGGTACATCCACGAT

TTCCTCAAATATGAGTTCGACATCGAGTTTGAA - UNI21700 - ATTCCTATCACATATCCCACTACTGCTCCGGAAATTGCAGTCCCTGAGCTGGA

CGGGAAGACAGCAAAGATGTACAG - UNI23683 - GGGTGGCAAAATATGTCTGACTGATCATTTCAAACCTTTGTGGGCCAGGAATGTGCCTAAGT

TTGGACTAGCTCATCTCATGGCCCTGGGG - UNI23643 - CTGGGTCCTTGGCTGGCAGTGGAAGTCCCCGATCTGATCCAGAAGGGTGTGATCCAG

CACAAAGAAAAATGCAGCCAATGAAGGACTACGCCCCTGAGGCCGGACTGAGGGACCGTGGCTAGGCTCCATTCCTGTTTGCTCCTTTTTCAGGATTCCT

TCAAGGGTCACCTCTGGCTGTTACAAAGTAGCTGGAGGGACAAATAAGAAAACCCAACAATAGGGCAAGGTCACAAAGTTTCTAAATGAAACTGTACAGA

GAGATGAAAGATTTGGGCCTTGAAATAGGCGGTTTGTATCCCTTCTCCAAGTAGAGCCCTGGAGGCATTTTGGAGGCCTGGGGTGTAACTTACAGCACAT

AGCTTTTTGGTTTCTGGAGACAACCTGTCAATAAAAGCTGCTTCCCCTGG
Translation
MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIR - UNI14254 - - UNI16872 - - UNI18370 - YVENNKNSDNDWFRLESNK

EGTR - UNI19456 - RWFGKCWYIHDFLKYEFDIEFE - UNI21700 - IPITYPTTAPEIAVPELDGKTAKMYR - UNI23683 - RGGKIC

LTDHFKPLWARNVPKFGLAHLMALG - UNI23643 - LGPWLAVEVPDLIQKGVIQHKEKCSQ
Transcript ENSMUST00000080001
Sequence
TTCTGAGCATGAACGGAAGTCGTTCTCTGAGCAGGCTCCGGTGATTTAATGATAGGTGGACAGAGTAGCCCGCCTCCATTCTGTTCTTCCGGACGCTCAC

ACCC - UNI14254 - TAAAGATGGCGACGCCGTGAGTAAGTGACAAGCAACTGCACTTCCGCAGTTTTCCTGCTCCCTGGTCCAAGATGGCGGACGA

GGCCACTCGGCGGGTCGTGTCTGAGATCCCGGTGCTGAAGACCAACGCCGGACCCCGAGATCGGGAATTGTGGGTGCAGCGACTAAAGGAGGAATATCAG

TCCCTGATCCGG - UNI14254 - - UNI16872 - - UNI18370 - TATGTGGAGAACAACAAGAATTCGGACAATGATTGGTTCCGACTGGAG

TCCAACAAGGAAGGGACCCG - UNI19456 - GTGGTTTGGAAAATGCTGGTACATCCACGATTTCCTCAAATATGAGTTCGACATCGAGTTTGAA -

 UNI21700 - ATTCCTATCACATATCCCACTACTGCTCCGGAAATTGCAGTCCCTGAGCTGGACGGGAAGACAGCAAAGATGTACAG - UNI23683

 - GGGTGGCAAAATATGTCTGACTGATCATTTCAAACCTTTGTGGGCCAGGAATGTGCCTAAGTTTGGACTAGCTCATCTCATGGCCCTGGGG - UNI

23643 - CTGGGTCCTTGGCTGGCAGTGGAAGTCCCCGATCTGATCCAGAAGGGTGTGATCCAGCACAAAGAAAAATGCAGCCAATGAAGGACTACGCC

CCTGAGGCCGGACTGAGGGACCGTGGCTAGGCTCCATTCCTGTTTGCTCCTTTTTCAGGATTCCTTCAAGGGTCACCTCTGGCTGTTACAAAGTAGCTGG

AGGGACAAATAAGAAAACCCAACAATAGGGCAAGGTCACAAAGTTTCTAAATGAAACTGTACAGAGAGATGAAAGATTTGGGCCTTGAAATAGGCGGTTT

GTATCCCTTCTCCAAGTAGAGCCCTGGAGGCATTTTGGAGGCCTGGGGTGTAACTTACAGCACATAGCTTTTTGGTTTCTGGAGACAACCTGTCAATAAA

AGCTGCTTCCCCTGGTA
Translation
 - UNI14254 - MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIR - UNI14254 - - UNI16872 - - UNI18370 - YVENN

KNSDNDWFRLESNKEGTR - UNI19456 - RWFGKCWYIHDFLKYEFDIEFE - UNI21700 - IPITYPTTAPEIAVPELDGKTAKMYR - UNI

23683 - RGGKICLTDHFKPLWARNVPKFGLAHLMALG - UNI23643 - LGPWLAVEVPDLIQKGVIQHKEKCSQ

For any suggestions or comments, please send an email to unitrap@crg.es