Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000063108 (Zfp26)
Chromosomal location
Chr 9: 20239474 - 20264436 (-)
Description
zinc finger protein 26 Gene [Source:MGI Symbol;Acc:MGI:99173]
RefSeq_dna
NM_011753 
RefSeq_peptide
NP_035883.1 
UniGene
Mm.107441 Mm.398063 
MGI
MGI:99173 
Uniprot/SWISSPROT
P10076 
Uniprot/SPTREMBL
Q60912 O88246 O88247 Q8CE00 
Human Ortholog
ENSG00000198028 (ZNF560)
Omim not available
UniTrap UNI3444
Vector Insertion
Chr 9: 20250342 - 20263990
Public Clones AK0411 (sanger) RRU439 (baygenomics) RRR182 (baygenomics) (ggtc)
E076D11 (ggtc) 5SE287D09 (ggtc) 3SE287D09 (ggtc) IST14596E8 (tigm)
IST10951E2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22614
Vector Insertion
Chr 9: 20249430 - 20250189
Public Clones not available
Private Clones OST290038 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6701
Vector Insertion
Chr 9: 20246710 - 20248702
Public Clones BGC483 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000056684
Sequence
TCCGTCTCTTCCGGTGTGGCTTCGTGCGGCCCCCTTCTCTTTTTCTCG AAAGAAGGATTTCGGCCGTTGGAATCTGTCTTCGCGCCCCATCGCTCCAGG

AACCTGGCCATCCCGCTTCATTGTGAGCAGTGGGTGGAATTTGATGGAGCAGGAAAGTCCCAGG - UNI3444 - GAATTTAAGTCATCCAGATTAAG

GAGAATGAATCTCGTCATTTTCCACTTTGATGCATAAGTTTCCCTGACGTGTCCTTGGAATCGCAGAAGAATTTGGTCACATATTTTACCATCAGACTAA

AGAGATGGACTTGACTAGTTTGTCCTGTG - UNI22614 - AAAGTCTGCTTTCTGGTGACCAGAACTGCAGTCAAGGAGAAGAGACAGAGGGAGAAA

GCATGCTGGCTGATTGCCTGAAAAACTGTAATAAG GATGAGGCTGTGGATTTCTCTGAAGAGGAGTGGACTACAAAGGCTCCAACTCAGAACAGCAAGC

CTGGTGCTGTGGCGGTGGAGGAGCACACAAGCCTGGCCGCTGTAG - UNI6701 - AATTGGAAAAGCAACTACAAACCAAAGATTTAGCACCAGAGC

AGGATTTTTTGACAAGACACACCTTCATGGAGACACAGCAGGTG GATGCAGTGACCTTTGAAGATGTGGCTGTGGACTTTACCCAGGAAGAGTGGACCT

CACTGGACCCAGTTCAGAGGAACCTCTACAGAGATGTGATGCTGGAGAACTACCAGAACCTGGCCACAGTAG GAGGTCAGATGTTTAAACCCAGCCTGA

TCTCTTGGTTGGAGAAGAAAGTAGAGTTGACAGTAATAGAGCAAGGAATTCTCCAAG AATGGGAAATGCACCTTAAGACAAAAAGGACAGCACTTCAGC

AGGATAGATTTTGGTCAGATATGTCAAATGGGATGCAACTG ATGTTTCCC AAAAAGTGCACTCCGGAAAAATCTGTTGAATGCAGTGACTGTGGGGAA

ACTTTCGTTAATCAGCTAGAACTTCAGACACATAGTTCTTCTCATCGTGAAAAGAATATCCACAAATCAGAGGAGTGTGGA
Translation
  - UNI3444 -  - UNI22614 -   - UNI6701 - METQQV DAVTFEDVAVDFTQEEWTSLDPVQRNLYRDVMLENYQNLATVG GGQMFKP

SLISWLEKKVELTVIEQGILQE EWEMHLKTKRTALQQDRFWSDMSNGMQL MFP KKCTPEKSVECSDCGETFVNQLELQTHSSSHREKNIHKSEECG
Transcript ENSMUST00000098970
Sequence
CGGTAGTAGCAGGCCGGCTGGGCGGGTTCTGGTGAGGCTAG AAAGAAGGATTTCGGCCGTTGGAATCTGTCTTCGCGCCCCATCGCTCCAGGAACCTGG

CCATCCCGCTTCATTGTGAGCAGTGGGTGGAATTTGATGGAGCAGGAAAGTCCCAGG - UNI3444 - GAATTTAAGTCATCCAGATTAAGGAGAATG

AATCTCGTCATTTTCCACTTTGATGCATAAGTTTCCCTGACGTGTCCTTGGAATCGCAGAAGAATTTGGTCACATATTTTACCATCAGACTAAAGAGATG

GACTTGACTAGTTTGTCCTGTG - UNI22614 - AAAGTCTGCTTTCTGGTGACCAGAACTGCAGTCAAGGAGAAGAGACAGAGGGAGAAAGCATGCT

GGCTGATTGCCTGAAAAACTGTAATAAGGTATGAGGAACTATTGCATCCGTCTTTCCATGTAGACAGACTTATCTCCCAGGATTCCCGAGAAGGGTAAAG

CCCCTGACGAGGACTAATTATCCAGAAGAGGCTTTTCACATTGCTATAATGCTGTGTTTATAGTCATTCCTAGTTAGTCTTGACCATTGCAGTGCCAAAT

ACCAGGGGCTTTGACAGTGTTCTTAAAGATAATAAAGCATACATATTACTCTATTAAAAACTTTGTTTTCATATTTACCCCCTTTATAAAATATGTCTAG

GAGTAGTATTAAAACAAAGAGAGAAGATGAAAAAGATCAGGGTGTGGTGAGGTAAAAATGTTTGAAATGTGCCCTTAAAACCACTCTATTAGAGTAGATG

GATGGAGAGTGTGGGTCCCAAGAGACTATGGGAGACCTCACGCTCTCTCTAGGCATTGAGTTCTCTATCCTTAGTCCTCCGAGAGGACTGGTGGGGATAT

TAACTTGGCTGAAACAAGCATGTGGGGGTGGTTTAGGATTTTGTGACTTTTCAGGATGAGGCTGTGGATTTCTCTGAAGAGGAGTGGACTACAAAGGCTC

CAACTCAGAACAGCAAGCCTGGTGCTGTGGCGGTGGAGGAGCACACAAGCCTGGCCGCTGTAG - UNI6701 - AATTGGAAAAGCAACTACAAACCA

AAGATTTAGCACCAGAGCAGGATTTTTTGACAAGACACACCTTCATGGAGACACAGCAGGTG GATGCAGTGACCTTTGAAGATGTGGCTGTGGACTTTA

CCCAGGAAGAGTGGACCTCACTGGACCCAGTTCAGAGGAACCTCTACAGAGATGTGATGCTGGAGAACTACCAGAACCTGGCCACAGTAG GAGGTCAGA

TGTTTAAACCCAGCCTGATCTCTTGGTTGGAGAAGAAAGTAGAGTTGACAGTAATAGAGCAAGGAATTCTCCAAG AATGGGAAATGCACCTTAAGACAA

AAAGGACAGCACTTCAGCAGGATAGATTTTGGTCAGATATGTCAAATGGGATGCAACTG GGAAGAGAGCACAGTGGAGGGGAACCTGGTGACCCTGTTC

AAGTTGGAGCAGTTTTTAGTGAAGATTCATGCCCTCAAACTCACAGTAGTACTTCAAATACAGGGAACACTTTTGCGTGTAACTTAGATGGAAAAGACTT

TCAGCCACTCCTTAAAGAAACTTCTACTGAAGAGAACATTGTCCAGTTGAACCAGTGTGTAAAACCTTTGATTTTCACTCCAGATGTTTCCCAGAAAAAG

TGCACTCCGGAAAAATCTGTTGAATGCAGTGACTGTGGGGAAACTTTCGTTAATCAGCTAGAACTTCAGACACATAGTTCTTCTCATCGTGAAAAGAATA

TCCACAAATCAGAGGAGTGTGGACAAGCTTCTACTCATCCTATAAGCCATGGTGGGCATGTGATTCCCACTGAAAAAAAATACTATGAATGTAAGAAATG

TGAAAAATTTTTTACACATCCTGTGTACCTTAATATCCATATGCAAAGCCACACTGTGGAGAAACCCTATGACTGTAAGGAATGTGGGAAAGCCTTCACT

GAGCGCTCAAGCTTAATTGTGCATCTACGACAACACACTCGAGAGAAGTCTTACGAGTGTAAGGAATGTGGGAAAACCTTTATTCAACCCTCACGTCTTA

CAGAGCATATGAGAAGTCATACGGGAGAGAAGCCGTATCAGTGTGACCAGTGTGGGAATGCCTTTGCGTCTTCCTCTTACCTTACTACACACTTGAGAAC

TCATACTGGAGAGAAGCCCTTTGAGTGTAACATATGTGGGAAGGCATTCACACGTTCCTCTTACCTGCTAGGTCACATACGAACTCATACAGGTGAAAAG

CCCTATGAATGTAAAGTATGTGGGAAAGCGTTCAGTGGCCGTTCTTGGCTAACCATACACTTACGGAAACATACTGGAGAGAGGCCCTATCCATGTACAG

AATGTGAGAAAGCCTTCACCAGCTTCGCTCAGCTAACTGAACATATAAAAACTCACACTGGTGAGAAGCCCTTCCGGTGTAAAGTATGTGCAAGGACTTT

TAGAAATTCCTCATGCCTTAAGACTCACTTTCGAATTCACACTGGAATAAAACCATACAAATGTAATTACTGTGGGAAAGCCTTCACTGCACGCTCAGGC

CTTACTAAGCATGTACTAATTCACAATGGTGAGAAGCCCTATGAGTGTAAGGAGTGTGGGAAAGCCTTCAGTACATCTTCCGGCCTTGTTGAACATATAA

GAATTCATACAGGAGAGAAGCCCTTTGAATGTTACCAGTGTGGGAAAGCCTTGGCTCATTCCTCATCCCTTGTTGGACATTTAAGAACTCACACTGGAGA

GAAACCCTTTGAGTGTAATCAGTGTGACAAAACATTTACACGATCTTCTTATCTTCGTATTCATATGCGAACTCACACCGGAGAGAAACCATATGAATGT

AAAGAGTGTGGGAAAACTTTCCCTGAGCGCTCATGCCTTACTAAACACATAAGGACACACACTGGTGAAAGGCCCTATGAATGTAAGGAGTGTGGCAAAG

GCTTTATTAGCTTTGCTCAGCTTACTGTACACATAAAAACTCATAGTTCTGAGAGACCCTTTCAGTGTAAGGTATGCACAAAATCTTTTAGAAACTCTTC

ATCCCTTGAGACCCACTTCCGAATTCACACTGGAGTAAAACCCTATAAATGCAGTTACTGTGGGAAAGCCTTCACTGCTCGCTCAGGCCTTACCATCCAT

TTACGCAATCACACTGGGGAGAAATCCTATGCATGCCAAGAGTGTGGAAAAGCCTTTAGCACTTCCTCAGGCCTTATTGCACATATAAGAAGTCACAAAG

GAGAGAAACCCTTTGAATGTGACCACTGTGGGAAAGCCTTTGCTTCTTCATCTTATCTTAATGTGCATTTGAAAATTCACACTGGAGAAAAACCCTTTCA

GTGTACAGTATGTGGGAAAACATTTACGTGTTCTTCTTACCTTCCAGTTCACATGCGAACTCACACTGGAGAGAAGCCTTTTCAGTGTATAATATGTGGA

AAGTCATTTTTGTGGTCCTCGTACCTTAGAGTTCACATGCGAATTCACACTGGAGAGAAACCCTATGTATGTCAGTACTGTGGAAAAGCTTTTACAGAGC

ACTCAGGCCTTAATAAACATTTACGGAAACACACAGGAGAGAAACCATATGAATATAAGGAATGTGGGGAAAACTTCACTACTTCTGCTGATGCTAATGA

ACATGAAACTCCCCACTGGGGGGAGAACCTTTGAATGTAAGGGATTCAGAAAATTGATAGCCCTTGATCCATCATTTGCAATCAAAATTTATAGTCTATA

CAAGTCTTATTGATAAGCAACGTATAAAAAACATTCGGTTGCTATGTGCTGTAAAAACAACTCATTCTGAGGATGCTCTGAGTTTAAGGATTGTGGGAGA

AATCAAAATTTCATGATATATGTATGAACTGAAGGTTTGTAATATAGGGAACGAAAACCTTTAGTGTTTCTATGAGTGTTGATGCAAGACATGTAGAAAT

GTTTCTATGTTCACGTGTGGTCTCACAGTTGAGAAATGTCTTTCTGAAGTTTGGGAAGTAACTTTACATTTGAACACAAGCTACATGCGTGTAAGAGGGG

ATTTGCTTCAGTGTCTTGGATGGCAACACTTGGCTTTCTTGGGTGCTTCTCTATGAACTTTGAATATTTCTCCATTTGTGTATTTTTATGACCTCAATTC

CATTGTTAGTTTTCCTTTTTAAAATATTCCTGTTTGATGTGATTGAAACTTGTTTTTATCTAGTATCTGTTATATGTCCCATGTTGGCATTGTGAACTAA

TGACACAAACTCCCATCTCCTCACTACTTGTTAGTTTATTTGTTGTTGTTTTTTTCCCCTCTTTTCTTTGGAGACAGTCTCACTTTCTGGCCTAGTATAA

CATGAAAGTTATGTAGCCTAGACTGGTCCCTAGCTCATGGCAGTCTAGACCCAGCCTTCTGAGTGCATAGATTACAGGTGCAAGCCACCATACCTGGCTC

TTTCTACTGTTTTAAGTATAAACTTCACTAGCACTGAAAAAACCATCATGTTTTACAATTGTGTTCAGGTTCTTAACACAAGTAGGTTTGGATCTGACCA

ATACAATCCCTTACTCTGAGTTCTAAGTCTTTGGTAGCCATTCCATTCTCTGCTTGGAGTTCAGCTTTTCTTTAGGCTTTGCTTCTTAGATCATGTAGTA

TCTGTATTAACTCTACTTAGCTTTTTTATTTTTGTGACAGGGTCTTGCTGTAGCTCAAACTGACCTCAAACTCGCAAACCTTTTTGCCTCAGACTTACTG

CTAGAGTTATAGGCATGTGCCTTCATGCCTAGCTGGCGTATATCAATCTACATAATGTTCTCAAGGTGGAACTGTGTTATGGTCAGTTATTTTAAGACAT

CTAATTATCCTTTGGCCTCTATGGATAGTTAGTTTCTATACCTTGTTTGTTAGTATTGCTACATAGCGAGTGTAGCTATCTCTTTAAAGTCATGACCTTA

TGTTCTCAGATACAATCCCAAAAGTGACTTTGTTACTGTAATGACAGATATTGTCAGTGTGTATGTAACAACTGCCAATTTATATTCCCAG
Translation
  - UNI3444 -  - UNI22614 -  - UNI6701 - METQQV DAVTFEDVAVDFTQEEWTSLDPVQRNLYRDVMLENYQNLATVG GGQMFKPS

LISWLEKKVELTVIEQGILQE EWEMHLKTKRTALQQDRFWSDMSNGMQL GREHSGGEPGDPVQVGAVFSEDSCPQTHSSTSNTGNTFACNLDGKDFQP

LLKETSTEENIVQLNQCVKPLIFTPDVSQKKCTPEKSVECSDCGETFVNQLELQTHSSSHREKNIHKSEECGQASTHPISHGGHVIPTEKKYYECKKCEK

FFTHPVYLNIHMQSHTVEKPYDCKECGKAFTERSSLIVHLRQHTREKSYECKECGKTFIQPSRLTEHMRSHTGEKPYQCDQCGNAFASSSYLTTHLRTHT

GEKPFECNICGKAFTRSSYLLGHIRTHTGEKPYECKVCGKAFSGRSWLTIHLRKHTGERPYPCTECEKAFTSFAQLTEHIKTHTGEKPFRCKVCARTFRN

SSCLKTHFRIHTGIKPYKCNYCGKAFTARSGLTKHVLIHNGEKPYECKECGKAFSTSSGLVEHIRIHTGEKPFECYQCGKALAHSSSLVGHLRTHTGEKP

FECNQCDKTFTRSSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHTGERPYECKECGKGFISFAQLTVHIKTHSSERPFQCKVCTKSFRNSSSL

ETHFRIHTGVKPYKCSYCGKAFTARSGLTIHLRNHTGEKSYACQECGKAFSTSSGLIAHIRSHKGEKPFECDHCGKAFASSSYLNVHLKIHTGEKPFQCT

VCGKTFTCSSYLPVHMRTHTGEKPFQCIICGKSFLWSSYLRVHMRIHTGEKPYVCQYCGKAFTEHSGLNKHLRKHTGEKPYEYKECGENFTTSADANEHE

TPHWGENL

For any suggestions or comments, please send an email to unitrap@crg.es