Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000063281 (Zfp35)
Chromosomal location
Chr 18: 24148182 - 24163230 (+)
Description
zinc finger protein 35 Gene [Source:MGI Symbol;Acc:MGI:99179]
RefSeq_dna
NM_011755 
RefSeq_peptide
NP_035885.2 
UniGene
Mm.290596 
MGI
MGI:99179 
Uniprot/SWISSPROT
P15620 
Uniprot/SPTREMBL
O88236 Q3TXW6 Q3V142 Q9QWN0 Q9QWN1 Q9QWN2 
Human Ortholog
not available
Omim not available
UniTrap UNI20677
Vector Insertion
Chr 18: 24148233 - 24148678
Public Clones not available
Private Clones OST355011 (lexicon) OST292786 (lexicon) OST167756 (lexicon) OST131192 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1806
Vector Insertion
Chr 18: 24148892 - 24161416
Public Clones CC0074 (sanger) D074E11 (ggtc) A042A03 (ggtc) IST14900E4 (tigm) IST14675A5 (tigm)
Private Clones OST446019 (lexicon) OST150188 (lexicon) OST150171 (lexicon) OST150127 (lexicon)
OST142970 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000084735
Sequence
TGTGAGGAATGTGGAAAGGCCTTTCGGATGAGCTCAGCCCTGGTTCTGCATCAGAGAATTCATACTGGAGAGAAGCCCTATCCTTGTAGTTGGTGTATTA

AAAGTTTTAGTCGGAGCTCAGACCTTATTAAACATCAAAGAGTCCACACTGGTGAAAAACCTTACAAGTGTGATGAGTGTGGCAAGGCCTTCAGTCAGAG

CTCAG ATCTTATTAATCATCAACGAATTCACACCGGAGAGAAGCCTTACCCATGTAGTCAGTGCAG TAAGAGTTTCAGTCAAAGTTCAGACCTCACTA

AACATCAGAGAGTGCATTCTGGGGAGAAG
Translation
CEECGKAFRMSSALVLHQRIHTGEKPYPCSWCIKSFSRSSDLIKHQRVHTGEKPYKCDECGKAFSQSSD DLINHQRIHTGEKPYPCSQCS SKSFSQSS

DLTKHQRVHSGEK
Transcript ENSMUST00000074941
Sequence
AGTTTCTTCATCGTCGGAGAGTAAGGGAGGCTTCTTGGGCATGGAGAGCAG - UNI20677 - AAACTCTAGTCTCAGAAATGACATCTCTCCTCTGT

ACAATGGTTCTCATCTGAGCTCAGGGCTACCAAGTTGCCTGCTGGCTTCAAACCATTATGTGGACAAAAGGATCCTACAGAAGAAATGGTAATTCTCCAG

TTGCTTCCTGAGGTGTCCAGTTGTGCCCTATGGAGATCCAATTCAGTTACGAATCTCAAGACCATCACTTTCTGTCAG - UNI1806 - ATGGTGAGA

CTAAGATCAAGATTGGAGAGCCAGCTACAGAGGAGGAAATGACAGGAAAGATTGGAACAGTGACTGAAGAGTCCGGCAGCCTTGAGGAGGATGTTCCCCA

TGACTCCAGAGGCAAAGAATTCCGTGAATTTGGAGAAGAATTGAACGATCAGATGCTTTTCAGAAGAAGACAGTATAACTGTGATGAATGTGACCAAAGC

TTTGCTTGGAGTACAGGTCTCATTAGGCACCAAAGAACTCATTGGAAACCTTACGAATGTGAGGAATGTGGAAAGGCCTTTCGGATGAGCTCAGCCCTGG

TTCTGCATCAGAGAATTCATACTGGAGAGAAGCCCTATCCTTGTAGTTGGTGTATTAAAAGTTTTAGTCGGAGCTCAGACCTTATTAAACATCAAAGAGT

CCACACTGGTGAAAAACCTTACAAGTGTGATGAGTGTGGCAAGGCCTTCAGTCAGAGCTCAGATCTTATGATACATCAGAGAATCCACACAGGAGAAAAA

CCCTACCAATGTAGTCATTGTAGTAAAAGCTTTAGCCAGCACTCAGGCATGGTTAAACATCTGAGAATCCACACTGGAGAGAAGCCTTATATGTGTAACC

ATTGTTACAAACATTTCAGTCAGAGCTCTGATCTTATAAAACATCAAAGGATCCACACTGGGGAGAAACCATACAAGTGTGATGTGTGTGGGAAGGCCTT

TAGTCAGAGCTCTGATCGTATTCTCCATCAGAGAATCCACACTGGGGAGAAGCCATATCCGTGTGCTCAGTGTAACAAAAGTTTTAGTCAAAATTCAGAC

CTTATTAAACACAGAAGGATCCACACTGGAGAGAAACCGTATAAATGTAGTGAATGTGGGAAGGCTTTTAACCAGAGCTCAGTCCTTATTCTGCATCAAA

GAATTCATACCGGAGAGAAACCCTATCCGTGTAACCAGTGTACCAAAAGCTTTAGTAGGCTTTCAGATCTTATTAATCATCAACGAATTCACACCGGAGA

GAAGCCTTACCCATGTAGTCAGTGCAGTAAAATGTTTAGTAGAAGGTCAGACCTTGTTAAACATTACAGAATCCACACTGGGGAGAAGCCCTATGAGTGT

GATAAGTGTGGCAAAACTTTCAGTCAGAGTTCCAACCTTATTCTCCACCAGAGAATCCACACTGGAGAGAAACCATACCCGTGCAACAGCTGTTCTAAAA

GCTTCAGTCGCGGTTCAGATCTCATAAAGCATCAGAGGGTCCACACTGGAGAAAAACCATACACGTGCAATCTGTGCAGTAAGAGTTTCAGTCAAAGTTC

AGACCTCACTAAACATCAGAGAGTGCATTCTGGGGAGAAGCCCTACCACTGTAGTAGTTGTAACAAAGCCTTTCGTCAGAGTTCTGACCTTATTCTCCAC

CACAGAGTTCACACGGGAGAAAGACCATATGCGTGTACACAGTGCCCTAGAAGTTTCAGTCAAAAGTCAGACCTGATTAAACACCAGAGAATTCACACTG

GAGAGAAGCCATATAAATGTATGTGTGGGAAGGCTTTCAGTCAGTGCTCAGCCTTTACCCTTCATCAGAGAATCCACACTGGAGAGAAACCGTATCCCTG

TGCTCAGTGTGGCAAAAGCTTCAGTCAGCGCTCTGATCTGGTTAACCATCAAAGAGTTCACGCTGATCAAAAACTACAAATGTGACTGATACCTGTGTGA

AGCCTTCAGCACTGTGACCAATCTTACTGGATATCAGAGGATCTGCAGGAGCCGTTTGCACCTCTCTGAAACGAGAAAAAGGAAGAGTGCCTCCCAGGCG

GAATCAAAGCAGGTCAGTTGGCAGAGTTCCCGGCTTGCTGATGCATGGAACAATGAGAAGAGGTGTGCTTGAGGCTCAAGTCAAGGGCTGAATCTTCTGT

TGACCTTGGTGGAAGGAACGGGGCTTACTGGATGGGAACAGATGTCTTGTGTGTATATTGCAGCAAATTGTTAATACTGGCTTGTGGCTTTGCTCCCCAT

GGTACTGTAGTATAAAAAAGGCTATGAGAAATACACTCACTGCTGGCGTGGTAATGACCTGCAGCCCTCCC
Translation
 - UNI20677 - MEIQFSYESQDHHFLSD - UNI1806 - DGETKIKIGEPATEEEMTGKIGTVTEESGSLEEDVPHDSRGKEFREFGEELNDQML

FRRRQYNCDECDQSFAWSTGLIRHQRTHWKPYECEECGKAFRMSSALVLHQRIHTGEKPYPCSWCIKSFSRSSDLIKHQRVHTGEKPYKCDECGKAFSQS

SDLMIHQRIHTGEKPYQCSHCSKSFSQHSGMVKHLRIHTGEKPYMCNHCYKHFSQSSDLIKHQRIHTGEKPYKCDVCGKAFSQSSDRILHQRIHTGEKPY

PCAQCNKSFSQNSDLIKHRRIHTGEKPYKCSECGKAFNQSSVLILHQRIHTGEKPYPCNQCTKSFSRLSDLINHQRIHTGEKPYPCSQCSKMFSRRSDLV

KHYRIHTGEKPYECDKCGKTFSQSSNLILHQRIHTGEKPYPCNSCSKSFSRGSDLIKHQRVHTGEKPYTCNLCSKSFSQSSDLTKHQRVHSGEKPYHCSS

CNKAFRQSSDLILHHRVHTGERPYACTQCPRSFSQKSDLIKHQRIHTGEKPYKCMCGKAFSQCSAFTLHQRIHTGEKPYPCAQCGKSFSQRSDLVNHQRV

HADQKLQM

For any suggestions or comments, please send an email to unitrap@crg.es