Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000063626 (Unc5d)
Chromosomal location
Chr 8: 29762522 - 30329810 (-)
Description
unc-5 homolog D (C. elegans) Gene [Source:MGI Symbol;Acc:MGI:2389364]
RefSeq_dna
NM_153135 
RefSeq_peptide
NP_694775.1 
MGI
MGI:2389364 
Uniprot/SWISSPROT
Q8K1S2 
Uniprot/SPTREMBL
Q5DTV3 
Human Ortholog
ENSG00000156687 (UNC5D)
Omim not available
UniTrap UNI16074
Vector Insertion
Chr 8: 30001983 - 30329713
Public Clones not available
Private Clones OST466805 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34391
Vector Insertion
Chr 8: 29955205 - 29986112
Public Clones IST14791H9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000078597
Sequence
ATGGGGACAGGGGCTGCAGACGGCAGCCGCGGGGCGCGCCGGTGGCTCCCATGGCTAGGACTCTTTTTCTGGGCGGCGGGGGCTGCGGCTGCCCGAG - 

UNI16074 - GAGCCGATGGCAGTGAAATTCTTCCCGACTCTATCCCATCTGCCCCTGGAACGCTGCCTCATTTCATCGAGGAGCCCGAAGATGCATAC

ATCATCAAGAGCAACCCGATTGCACTCAGGTGCAAAGCAAGGCCAGCCATGCAGATCTTCTTCAAATGCAATGGGGAGTGGGTCCATCAGAATGAACATG

TGTCCGAGGAGAGCCTGGATGAGAGCTCAG - UNI34391 - GCTTGAAGGTCCGGGAAGTGTTTATCAATGTCACCAGGCAGCAAGTGGAGGACTTC

CATGGGCCAGAGGACTACTGGTGCCAGTGTGTAGCGTGGAGCCACCTGGGAACGTCCAAGAGTAGGAAGGCATCTGTGCGCATAGCCT - UNI34391 

- ATTTACGGAAAAACTTTGAACAAGATCCACAAGGCAGGGAGGTTCCTATTGAAGGCATGATCGTGCTGCATTGTCGCCCGCCAGAGGGAGTTCCAGCA

GCAGAG - UNI34391 - GTGGAATGGCTGAAAAATGAGGAGCCCATCGACTCCGAACAGGATGAGAACATTGACACCAGGGCTGACCATAACTTGAT

CATCAGACAGGCCCGGCTGTCAGACTCAGGGAATTACACCTGTATGGCAGCCAACATCGTGGCCAAGAGGAGGAGCCTCTCAGCAACTGTGGTGGTCTAC

G TGAATGGAGGCTGGTCTTCCTGGACAGAGTGGTCAGCCTGCAATGTTCGCTGTGGTAGAGGATGGCAGAAACGTTCCCGGACCTGCACCAACCCCGCT

CCTCTCAATGGTGGGGCCTTTTGTGAGGGAATGTCAGTGCAGAAAATAACCTGCACTGCTCTTTGTCCTG TGGATGGCAGCTGGGAAGTGTGGAGTGAA

TGGTCAGTCTGCAGCCCAGAGTGTGAACATCTTCGTATCCGTGAGTGCACAGCTCCACCCCCAAGAAATGGGGGCAAGTTCTGTGAAGGTCTCAGCCAGG

AATCTGAAAACTGCACAGATGGTCTCTGCATTCTAG ATAAAAAACCTCTTCATGAAATAAAACCCCAAA GATGGAGTAGGAGAG GCATTGAGAATGC

CAGCGACATTGCTTTGTACTCCGGCTTGGGTGCAGCCGTGGTAGCTGTTGCGGTCCTGGTCATTGGTGTCACCCTCTACAGACGGAGCCACAGTGACTAC

GGAGTGGATGTCATTGACTCTTCTGCATTGACAGGTGGCTTCCAGACCTTCAACTTCAAAACAGTTCGTCAAG GAAATTCTCTACTACTGAATCCTGCC

ATGCAGCCAGATCTGACTGTGAGCCGGACATACAGCGGGCCCATCTGTCTGCAGGATCCGCTCGACAAGGAGCTCATGACAGAGTCCTCACTCTTCAATC

CTTTATCTGACATCAAAGTCAAAGTCCAGAGCTCATTTATGGTTTCCCTGGGAGTGTCTGAGAGAGCGGAGTACCATGGCAAGAATCACTCGGGGACTTT

CCCCCATGGAAACAACCGCGGATTCAGTACAATACATCCCAGAAACAAAACGCCGTACATCCAAAATCTGTCATCACTGCCGACAAGGACAGAGCTGAGG

ACAACTGGTGTCTTTGGCCATTTAGGGGGACGCTTAGTAATGCCAAATACAG GGGTGAGTCTACTCATACCACATGGTGCCATCCCAGAGGAGAATTCT

TGGGAGATTTATATGTCAATCAACCAAGGTGAACCGAG CCTGCAGTCAGATGGATCTGAGGTTCTCCTGAGTCCTGAAGTCACCTGTGGGCCTCCAGAT

ATGCTTGTCACAACTCCCTTTGCGCTGACCATCCCTCACTGTGCAGACGTCAGTTCAGAGCACTGGAACATTCACCTGAAGAAGAGGACCCAGCAGGGGA

AGTGGGAG GAAGTGATGTCAGTGGAGGATGAGTCCACATCCTGTTACTGCCTCTTGGATCCCTTTGCCTGTCACGTGCTGCTTGATAGCTTTGGAACGT

ATGCCCTCACAGGAGAGCCAATCACAGACTGTGCCGTAAAGCAGCTCAAGGTGGCTGTGTTTGGCTGCATGTCCTGTAACTCCTTGGATTACAACCTGAG

AGTTTACTGTGTGGACAATACTCCTTGTGCATTTCAG GAAGTGATTTCTGACGAACGGCACCAAGGCGGCCAGCTCCTGGAAGAACCAAAGCTGCTGCA

TTTCAAAGGGAATACATTCAGTCTCCAGGTCTCTGTCCTTGACATCCCTCCCTTCCTCTGGAGGATCAAACCGTTCACTGCATGCCAG GAAGTCCCCTT

CTCCCGAGTGTGGAGCAGCAACCGGCAGCCCCTGCACTGTGCCTTCTCCCTGGAGCGCTACACGCCCACCACCACCCAGCTGTCCTGCAAAATCTGCATT

CGGCAGCTCAAAGGCCATGAACAGATCCTCCAAGTGCAGACATCCATCCTAGAG AGTGAACGAGAAACCATCACTTTCTTCGCACAAGAGGACAGTACC

TTTCCTGCACAGACTGGCCCAAAAGCCTTCAAAATTCCCTATTCCATCAGACAGAGGATCTGCGCCACGTTTGATACCCCAAATGCCAAAGGCAAGGACT

GGCAGATGTTAGCACAGAAGAACAGCATCAATAG GAATTTATCATATTTCGCTACCCAAAGCAGCCCTTCCGCTGTCATTTTGAACCTCTGGGAAGCTC

GTCATCAGCAGGATGGGGACCTCGACTCGCTCGCCTGTGCCCTTGAGGAGATTGGGAGGACACACACGAAACTATCCAACATCACAGAGCCACAGATTGA

TGATGCTGACTTCAACTACAGCAGGCAAAATGGACTCTAGTCTGTTTCTTCTCCGGAGGCAGCACTAGTGATGGCCTGCTTCAGAGCAGTGGCTTCAAGT

GGGGAAGACAGGGCAGATTTCTGCCCCGGGGCATTTGGGGGGGAACTCAGCCTTTATTGAGAGTCAGTGAGAAACCCTGGATGAAGAAAAGGAGTTTGAT

ATAGGTAAAAACATGTTAACGGTGGGGGAAAAAGAGAACCCCGCTATACCCTCTGAATCCACACATGGGTAGACATTGGATATGCTCCTCAAATTCAGAC

TGCCGAGGATTAAAAAGTGAAGGTATCTGTAGATACAAGTAGTTTTGAAAACCAGATACACAACAATAAAGCCGGGAAGGCAGAGATTTAAGTGCATGCT

TGGAAACAGGTTTTTAATGACTTGCCCCACGGGCCAGATGATCCTGAGACCAGATTTTCAGATTCCAACCGACTGGCATCCCAGAGGTTGGAAATCATAA

TAAGACTAGCTTTCAGAAGTGAAAGCAGATTGCCAACTTATTAGTAAGATGTCATCAATGTCAGGGAGGGCATTTAGAATTTAGAATCTGAGTACATGAC

ACCAGCACTTATTATATGAGTCACTTAACAGAGACAAGATCAAGAAGGGAGATAGACCTCAAACTAGTTCTTGGTACCTCACCTTCATCCCCCACCCACC

CACTCCCGAGACAAAACTCATTTCTCTCCTATCCTAAAAGATTGCAGTATGGAGACAG
Translation
MGTGAADGSRGARRWLPWLGLFFWAAGAAAARG - UNI16074 - GADGSEILPDSIPSAPGTLPHFIEEPEDAYIIKSNPIALRCKARPAMQIFFKC

NGEWVHQNEHVSEESLDESSG - UNI34391 - GLKVREVFINVTRQQVEDFHGPEDYWCQCVAWSHLGTSKSRKASVRIAY - UNI34391 - YL

RKNFEQDPQGREVPIEGMIVLHCRPPEGVPAAE - UNI34391 - VEWLKNEEPIDSEQDENIDTRADHNLIIRQARLSDSGNYTCMAANIVAKRRSL

SATVVVYV VNGGWSSWTEWSACNVRCGRGWQKRSRTCTNPAPLNGGAFCEGMSVQKITCTALCPV VDGSWEVWSEWSVCSPECEHLRIRECTAPPPRN

GGKFCEGLSQESENCTDGLCILD DKKPLHEIKPQR RWSRRG GIENASDIALYSGLGAAVVAVAVLVIGVTLYRRSHSDYGVDVIDSSALTGGFQTFN

FKTVRQG GNSLLLNPAMQPDLTVSRTYSGPICLQDPLDKELMTESSLFNPLSDIKVKVQSSFMVSLGVSERAEYHGKNHSGTFPHGNNRGFSTIHPRNK

TPYIQNLSSLPTRTELRTTGVFGHLGGRLVMPNTG GVSLLIPHGAIPEENSWEIYMSINQGEPS SLQSDGSEVLLSPEVTCGPPDMLVTTPFALTIPH

CADVSSEHWNIHLKKRTQQGKWE EVMSVEDESTSCYCLLDPFACHVLLDSFGTYALTGEPITDCAVKQLKVAVFGCMSCNSLDYNLRVYCVDNTPCAFQ

 EVISDERHQGGQLLEEPKLLHFKGNTFSLQVSVLDIPPFLWRIKPFTACQ EVPFSRVWSSNRQPLHCAFSLERYTPTTTQLSCKICIRQLKGHEQILQ

VQTSILE SERETITFFAQEDSTFPAQTGPKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSINR RNLSYFATQSSPSAVILNLWEARHQQDGDLD

SLACALEEIGRTHTKLSNITEPQIDDADFNYSRQNGL

For any suggestions or comments, please send an email to unitrap@crg.es