Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000063801 (Ap3s2)
Chromosomal location
Chr 7: 87020218 - 87065487 (-)
Description
adaptor-related protein complex 3, sigma 2 subunit Gene [Source:MGI Symbol;Acc:MGI:1337060]
RefSeq_dna
NM_009682 
RefSeq_peptide
NP_033812.3 
UniGene
Mm.220173 Mm.409969 
MGI
MGI:1337060 
Uniprot/SWISSPROT
Q8BSZ2 
Uniprot/SPTREMBL
Q6PAL3 Q8BNE3 
Human Ortholog
ENSG00000157823 (AP3S2)
Omim not available
UniTrap UNI2618
Vector Insertion
Chr 7: 87027460 - 87054720
Public Clones XR0706 (sanger) AE0788 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18950
Vector Insertion
Chr 7: 87025499 - 87027351
Public Clones not available
Private Clones OST409046 (lexicon)
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000075657
Sequence
CCGAGAGAAGCGGGACCGGCAAAGATGATTCAGGCGATTCTGGTTTTCAACAACCATGGAAAACCGCGGCTGGTCCGCTTCTACCAGCGTTTT CCAGAA

GAAATTCAACAGCAGATTGTTCGAGAGACTTTCCATCTGGTCCTCAAGCGAGATGACAACATCTGTAACTTCTTAGAAGGTGGAAG TTTGATTGGTGGC

TCTGACTACAAACTGATTTACCGGCACTATGCCACCCTCTACTTTGTGTTTTGTGTGGATTCATCAGAGAGTGAACTTGGGATCTTGGACCTCATCCAG 

GTTTTTGTGGAGACACTGGATAAGTGTTTTGAGAATGTATGTGAGTTGGACTTGATCTTCCATATGGATAAG - UNI2618 - GTGCACTACATCCTG

CAGGAGGTGGTGATGGGTGGAATGGTGTTGGAGACAAACATGAATGAAATTGTGGCTCAAATCGAAGCTCAAAACCGACTGGAGAAGTCGGAG - UNI1

8950 - GGCGGCCTCTCTGCAGCTCCAGCAAGGGCCGTGTCCGCTGTGAAGAACATCAACCTCCCTGAGATCCCCAGGAACATCAACATCGGTGACCTC

AACATCAAAGTCCCCAACCTGTCCCAGTTTGTGTGAAGGTGGGGGACTGGGCTGAACTGGAGTTCGCAGGATGAGCAAAGCAGTCAAGTCCAGAAGCAGA

ACCCCGTTGAGCCTTTAGAGTCGCACCTTGGGGCCCTGCACCTTTCCCAGAGTGGGAATGGAGTTGGGTGCACACTTCCTGGCCATCCTGCTGCTCCTGA

CTCACGGCTGTGATAGACATCAGGGCACTAAGCCACTGCTCCTTCGCCTCCCCCACACAGCTGCCCTCAGGGCCAGGGACTGTGAACGCGCCACCTGCTT

CCCAGGGCCCCACCACTGGGACTGAACACATCTGACTTCCTCTCTAGCACCAAGGGCTTCTGAGATCCTGTATCACTTACTGGGGGAAAGACCAGGGGGA

AAGACTAGCCTTTGAGCTGTCAGGCATGGTAAGTGGCAGGTGAGGGCAGGGTGTACACCACCTCTGCTAGGGCCTCTATACCCTCTGAATGGTCAAGCAT

TGTGGTCCGCAGTTGCTGCAGAGCAGTTTCCTAGTATATACCTAGTCTTGTTGTCAGAGGCATCTGTGCGCTGGATGGTTTAAGTCACACTCTGTGTGCG

TGCCACTACCACCCCCCCCCCCCACACACACACACACAGAGTTGGTGCGACCCCCAGAACCCTCTCGCAGAGGAGACCAATGTCTGTAGACTGTGGCGAC

TGGATCCCTCCTAGGTTATGACTTTTCCCAAGTTTAAAATACACTGTTCTCTTGGAAGCAGAAGGTTCAGTGCTGTGCTGTGAATGAAGAAGTCCCCACA

TACACACACTTGCTCAGAATCCACTAACCAGTCTCAGATTCTAGAGCTGGGAGCCTGGGCTGGGTGCTATATGGGCTGAGCCTGCAGCATGCTAGCTGTA

GTGCTGTGTGCTTCCCAGCTTGAGTCCTGCAGTGAACACACTGGGCTCCCTTGGTTGACATTCTACAGCTCTGGAACCCTGCAAAGTTGCATGTGCTGGT

GTGGAGGCTGATGCACCGCCATGGGGAACCGCCCCACGCAGGCCCCTCTCCCTCCCTCCCGATAGGATAGTGTATTTCCATGGCTTGTGATGCTGATGTC

CTAGGAGACCGTGTGTCTTACCCAGTGTGTCTCAGTCCCCAGCAGGGCTTCCTGCACTCTGCCGGTGCTGATGCAGCATCCTGTCCTCACCTTTCAGTCC

TCTGTCAGAGCTGCAGTGATGGTGGGCACTTGGCTAGAGGACAGACCTGAGATCAATCCTACTGCATTCTCTGGAAGCATCTCATTGCTATTTTATGTTA

TTTTATTGCCATTTGTGTACATTCATCTCCTTTTACAGTGGCTGGAATCAAGCATTTGCTCTAGGGGGACATGAAGAGTCCTTTAATAGTCCTTACTAGA

GACATTTTTTTAAGCTTTATTTTATTTCTGGGGTGTGTCTGTCTGTCTGTCTGTCTGATGGTATGCTCTGAGGCCAGAGGAGAGTATACATGCCCTCTGA

GGCTAGAGAAGGGTATGGAATTCCTTGGACCTCAAATTAACAGGAGGTTGAGAAGCCCCCTAAAATTGTGGTGCTGGGAAGCAGACTCAGGTCCTCTGCA

AGAGCAGCAGTGCTCTGAACTGGAGCCACCTCTCTGGCCCCACCCATGGACATTTTACTGCCTGGTTAAGCAGACTTTTGTCACCCAGGGCTAAGGTTGG

AAACGTGCCTGCCTGGCTCCAAAGCTCTTTTTTTTTCTCCTTACTATTCAAGATAGTCTCTCCCAGTTTTACAACCCTCTCTTTTATAGATGACAGACAG

GGAAACTGAGACTTCAGGGGATTGAGCAATCTCACAAACTAATAAAGACAGGCTTAGTTCTCTAAGGTAGGCAGAGGAGAGTGGAGGATCCTGTGTCCCT

TCAGTTAATTGCCTGAGATGGAGCCGCCCAGAGTGCTGTCAGGCTGAGGGTCAAAAGGGCCACAGTGCTGCTCTAAAGTATGCTTGCTGTTGGCCTAAGG

CACCATTGAGTTGGAAGCACTTGGCTTCCCAGGTAGTTTAGATTTCAGGTGTTTGCTTGCTAGAAACTACTTGGTTCCCCAAAACTGTGTCCTGGTACTG

TAGACTGCAAAAGCAAGCATCACACAACGGCTTGCACCATGTCCCCTGACAGTCTGCTGGTTCAGGCTTGGAAAACTCAATTCCTCTAGTCAAGCCAGAG

GGATTAATTCATTGCTAATGACTTGCATCTACTTTGTCTGCTATTAAGAAAGCCATTGTCTGAGATTCTCATTCTCTCTCTCTCTCTCTCTCTCTCTCTC

TCTCTCCCCCCTCCCTCCTTCCTTCCCTCCTTTCCTTCCTCTTTCCCTCTCCCCCCTTTGTGCTTTGAGACAAGATCTCACTTTGTAACCTAAATTCTCA

ATCCTCCTGCATCACCTCCAAAATGCTGAGATTACAAGTGCCCTGTGCACTTTGCTGTGACATAGAGGAAGTCCTTGGTCCTTCTGGAGAGGGGTGTTCC

TTTTGCTCTTGAGACATCAGTGACGCAACCAGAGGCCAGGGTTGTGTTTGCCTTGGGGTCCTGGACCTGGGTGGTTACACAGGGGCTTCCCTGGGTGTTC

TCACTGACTCTAGTTAACAGCTGGAACCCCCCACTCCCTGTCTTCTGTGTAACTACTCTTGGGTCTAAACTAAGAGAGAGGCTGTCTTTGCTCCACTGTC

TTTGACCATCCCTGACAGTGCTCTGTAGTGACAATTCTGGAACTTTGATTTTTTTTTTTTAAAAGAAAGAAATAAGAATACATTTTTGGTTTACTCCCAG

GCGTGGGGTTTTGGGTCTACTTCACAGCAGCTGACCATGACTTACCTTATGCTCTAGCAGATGGTTTCTGCGATTGTGTGACGTTTGGAACTTTTTAGAG

GGTATATACTGCTAGGGCCCAGATAGGTGGGATCAGTGGTTGTTGGTTGTTGGGGGTTGGGGGGGTGGTTGGTTATAGTTTTTAGTAGTTTGTGTTCAAA

GAAGAAACAGAAAGAAATTTGATTCTGAGATCTCTATTTCTCTCTCTCCCACCTCTATCCTCTCTCTTCTATCTAATGATAGGGGGTGAAAATGAGGGGC

TAAAGGGTAGGGAAAAGAAGGACCCACAAAAGTAGCAAAGACCAGCTATAAGCGAAAAGAAACAAGAAGGAATTAGATTCAGAGATCTCTATCTTTCTCC

CCTCTCTCTGTTCTCTCCTATCTAGTGATAGAGGTAAAACTTGGGGGGGGGGGGTCGTGTAAAGGGTGGGAAAAGAACTCACAATATAGCAAGGCCCAGC

TACAGTGCTTACGTGGTTGGAACATGGGCACTGACTGGCAGCCTGGCACCATGGAGGCCAGACTCTGACTGCAGTGTGGAAGATTTAAAGGACAGTCCCC

ACCCCTGACTTGCCAGTGTCATGCCTACTGCATACAGTGCTGGACAAATTACCTTTCCCAAGCCTGACCATGGCACCATACATGCTACACTGAGGGTAGC

GAGTCTCCTAGCCCTGATGTTTCGTCCTCTGCCAGATGCAGAGCCAGCCCTCTCTCCCTCCCTCCCTCACCACTGCAGAGCCAGTTTAGCAATTCTTTCT

GTGACCTCAGCTTCAGAAAAGAAATTAGGAGCAATGCCTCTGCCTAGGTCCCAGACACGATCCCTGGCCTGGCCTGGCCTGTAAAGGCTTTCCTCAGCAT

GGCCACATCAGCCATGGGTACCTGGAAATGAAGCTCCAGAGCAGGTCCCTGCCCTCCTTCACAGTGACCAAGAGGAGTACTGAGCCCCACCTGCTCTGCA

CACATCCTGGATGCCCACTCTTCCAAGTGTGCTGACCACCCAGAGTGAGCCAGCTCTTTGTGGGGGCTGCCAGGCTAGGCCCAAACCTCAAGGTCACAGT

AAGCCTTGACCTTTTGGGAAGCTGTGGGGTGTTCTTCACCTGCATGTTCTGGCAGATGGGGCTGTTGAAATACCTCAATGCAAGTGATTAACCCTTTCCA

GAGCTCTTTCTTATTTCAACTCTTCCTTTCCAAATAAGAACTTAATTTATGTAGTTCGGGTTTTGAGGGGTTTGTTTTGTTTAGTTATTCTGTTTTGTTT

TGATTTTCAAGACAAGATATCTCTGTAGCCCTGGCTGTCCTAGAACTTGCTCCATAGACCAGGCTGGCCTTGAACTCATAGATCTGCCTGCCTCTGGGAT

TAAAGGCATGCAACACCAACATCTGGCTATAGGTCAGTATTTTTACATGGAGGTGGAGAAGTACCCTCAGAGACCAGACGAAGGCCTTGGATCTCTTGGA

GCTGGAGTTGAATGGGGGTACTCTGAACTGCTGAGCCGTCTCTCCAGCCCCATGCACTTTACATGTTAAGAAAACAAAAAACCAGTTTAGCAGAGGATAG

CCTATTCCCAGCCACTGAGCACTGCCCTCCTGGCAGCAAGTGTTTGCAGTTTGAAGAAGAAACAAGCGTCCTTTATCTTCACTTTCAAAACTAAGGTCAT

AGCTTCAGTTGCCCTCAGCTCAGTACAGTCTTACTGTCCTCCAGAAATGCAGAGTCCACCCTACACATACACCTGTGAGCACTCACACCAAGAAGTCCAT

CCTTACAGTCCCACGGTACCTCTGCGTTCTAGGACTGTAGGACTGTGACATGGGAGTAGGGAGGCCCATGGGTGCAGGTGGAGGACAGCAAGGATTGTAC

CGAGAAAAGGATGAGATGATGGGCATGTTCGCTTGCTTGGGGATAAACGCCTGCTGGTGAGTGAGTGGACAGGAGAGCGTGGGTCCAGCTCTGTCACGTA

TGGAGTTGGAGTAAGTGACATGGCCAAGGGATGAGAGTAAAGGACAGCCTGGGCAAGGGCTGAGGAGTGTGCACATTGGAGCAACCTGACGTCCGGGGAG

AGCAGAACAGGAAACACACTGGTCAGACAGGAAGGGACCCCAGAGCCACAGCTCTAATCCTGCCTGGAAGCTGTATATGAGGGTATGAGCAGAGCTGGAG

AGACACTGCTCGCTCACCTCATGGACGGGTCATCTGCTCCTCCTCCTGTCCCACATCCCCAGCTTCACCATGAATCCTTTAACAAGCCCTGAACTTAACC

TAAGCCATTCACGGCGTCTCTTTTCTAGGACCTGTTCCTGCTCTACAGCTTGGCCTCCTAAACTATCAGAAACTATAATAAAACTTCT
Translation
MIQAILVFNNHGKPRLVRFYQRF PEEIQQQIVRETFHLVLKRDDNICNFLEGGS SLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQ VFVET

LDKCFENVCELDLIFHMDK - UNI2618 - VHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSE - UNI18950 - GGLSAAPARAVSAVKNIN

LPEIPRNINIGDLNIKVPNLSQFV

For any suggestions or comments, please send an email to unitrap@crg.es