Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000063849 (Ppcdc)
Chromosomal location
Chr 9: 57260475 - 57287921 (-)
Description
phosphopantothenoylcysteine decarboxylase Gene [Source:MGI Symbol;Acc:MGI:1914062]
RefSeq_dna
NM_176831 
RefSeq_peptide
NP_789801.1 
UniGene
Mm.408516 
MGI
MGI:1914062 
Uniprot/SWISSPROT
Q8BZB2 
Uniprot/SPTREMBL
Q3V3J2 
Human Ortholog
ENSG00000138621 (PPCDC)
Omim not available
UniTrap UNI22626
Vector Insertion
Chr 9: 57285290 - 57287876
Public Clones (sanger) D059H02 (ggtc) IST14664F5 (tigm) IST12901D9 (tigm) IST14508H3 (tigm)
Private Clones OST289802 (lexicon) OST287648 (lexicon) OST236527 (lexicon) OST199679 (lexicon)
OST157944 (lexicon) OST144171 (lexicon) OST73629 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10480
Vector Insertion
Chr 9: 57269029 - 57282709
Public Clones (sanger) D121G09 (ggtc) E052B05 (ggtc) D098D12 (ggtc) D050H09 (ggtc)
D121H09 (ggtc) FHCRC-GT-S10-11H1 (fhcrc) IST11154G3 (tigm) IST14131E9 (tigm)
IST12237H4 (tigm) IST14593C5 (tigm) IST12920D1 (tigm)
Private Clones OST298464 (lexicon)
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000085709
Sequence
GAAAGGCGCCTAGATACCGCGATACTTGCGGGTATCCTGGAGCTG - UNI22626 - GACTCTCCTGTTCTTGCCACATTTGACTGAAGAAGGACAAC

GGGGTCAAGGTTTGAGGACTGACAG ATTCTAGACCCAGGCTTCCTCAGCCCCCAGAAAGCCACCAGACCTCACATGGAACCAAAGGCCCCATGCCCAGC

CGCCGTCCCCTCAGAGGAGAGGAAGTTCCGTGTTCTTGTGGGCGTCACTGGCAGCGTGGCCGCTCTGAAGCTGCCTCTCCTGGTATCTAAGCTGTTGGAC

GTTCCTGGG - UNI10480 - CTGGAAGTCACAGTGGTAACAACAGAGAGAGCCAAACATTTCTACAGCCCTCAGGATGTCCCCGTCACCCTCTACAG

TGACGCTGATGAATGGGAG ATGTGGAAGCGCCGTTCTGACCCGGTTCTCCACATTGACCTGCGGAGGTGGGCTGACCTCATGCTAGTGGCTCCCCTCGA

TGCCAACACTCTGGGGAAGGTGGCCAGTGGCATCTGTGACAATTTGCTT ACCTGTGTCATCCGGGCCTGGGACCTAAACAAGCCCCTACTCTTCTGCCC

CGCCATGAACACTGCCATGTGGGAGCATCCTCTCACCGCACAGCAGGTAGCCCAGCTCAAGGCCTTTGGCTACGTGGAGATTCCCTGTGTGAGCAAGAAG

CTGGTGTGTGGAGACCAAG GTCTAGGAGCCATGGCTGAAGTGGAGACCATTGTGGCTAAGGTGCAGGCCGTGCTCTCCCAGCATGGTAGCATCCAGCAG

AGTTGACCTGGGATTTCTGCCGTGATGCCCCTGCACCCAGTGAGTTCAGCCTGAGCTGTTGAAGAAGGATATCAGCACAGTATGAAGCGCTTGTGCTGGT

TGACGAGGGGCTAGCCTGAACCTTCTTGGGATTTCCCTTCAGTCTAACCCTCTTCAAGCTACACGGAACCACAGACCCAGGTCCTACCTTCTTTCAACCA

AGAGATGCCTGCTTCCTGGAGGCCCTCCCATTTCTTTCTGGGATAGCCCAAATAGACTAGGCAAGCACGCTGCTACTGGAAGGGTAATTGAATGACTGAG

GGACCTCCTGCCTGGGAATTGCTTTTAGACACACCATGGATGAAGCTGGGCATGGAGGCTCACATCTGTAATCCTAGCACTCAGAAGGCTGAGGCAGGAT

TGCTACAACTTTGAAGTTGGCTTGGGTTACATAGTAAGCCAGGCCTTTGAGTGTGATAGCCTATATCAAAACAAAAGCAACAAGAAGAAACACCATAGCT

CAAGATCCCTGACATAGCAGGACACAGCAGGCTCCTGGTCAGGCTGGAAGCATCCAGTCTTTGGTGCCCAGGTGTCGCACACAGTCAAGAAGTCTGTGAG

GTGGCCAAACTCTTCAGATTTCCCACAGTCTGTACTGAGAGTAGGGGCACGAACAGGTCTGGGAAATAAAGAAAAGTGACCTTTTAGGAGACTGTGTCCT

TCTTTACATCCTGTCTGTGGCCTCAGAGGTCAGGGGCATGGCCATGTGAGGCCAGAGAAGGTTCCAGGCTGACGACTGACTAGCACGCCCACATTCCTGT

GCAGTCTCAAAGCAGACAGGTCAGATTCAGATCTCAATCCCACCTCCAGACCCAGACTGACCCTCGTTTTTCCATCTGCTGGGTCATGCGTCCATAACAG

AGCTGCCGAGAGGATTAAGTGAGGCAGATGTGAAAAGTGCATTTGTCTCTTACACCCACAGGGGATACACGCTTGCTCCCAGCAGCTCCTGAAGCCAGAA

CGCCATACATTATGACGTCTTTCTTTACATAAACTGTGACAAATTTTAATTTATAAATTAGGCCCAGTAAGAGATCAGCAACAATAATAAAATAGAACAG

TTATTCACTTTGTTCTGTAATAACTTATTTTCCATGCTGAAAGAAAAATAGAACAATTAAAAATATAATAGAGCCTGGCAAGATGGTTCAGTGTGTAAAG

GTGTTTGCCACCTTGTGTCACCAAGCTTCACAGTGTGAGTTTAATCCCTGGGAGTCACGTGGCGGAAGGAGAGAACCAGCCTCTGGAAGGTGACCTCTGA

CCGCCACCTCCACTCTCACACTGTCACAGGTACTATCTGCATGTGTACACACATACAAAACAGATACAGTAAATATTTAAAAACTTGTGTGAACTCAACA

TACAACTTTAAAATTGTATCAAGTCAAGAACTTAGACTTTCTGTTGTTTTGTTTTGTTGTCTCGAGACAAGGTTTCTCTTTGTATCCCTGGCTGTCCTGA

ACTTCCTCTTTATACCAGAGTAGCTTGGAACTCGGAGAGCCTCCCGTCTCTGCTTCTCGAGTGCTGGGATTAATAGTGTGTACCATCACACTTGGCCCAG

AACATCAAAGAAGGTTGATGCTTCTCTGGCTTCCCCGAGTTGTCTGCGTCCCGAGTCGTGGGCTGTTCCTGAGGTGAGAGGTTGCTTGAGCGCAAGGGCT

ATGCACCAGTGGTACTTGATTTGTAACGCTGCTGCAGTAGCGGACTGTCAGTCATATTCAGCACGGACATGCTAGACTAAGTGATGATTCCTGTCTGGGT

TGAGATGGAACAGGAAGTGTGGTATTTCGTGCTCCTCAGCGCAGCGTGTGACTTAAACTATGGATCGTTTTAATGAACTTTGGTATTTCAGGCTACGGTT

GACCAGGTAACAGAGAGCAACATTGCACGTAAGTGGAGACTTTTCTAACTGCTATGGAATACCCAGAATAATAAATGTC
Translation
 - UNI22626 -  MEPKAPCPAAVPSEERKFRVLVGVTGSVAALKLPLLVSKLLDVPG - UNI10480 - LEVTVVTTERAKHFYSPQDVPVTLYS

DADEWE MWKRRSDPVLHIDLRRWADLMLVAPLDANTLGKVASGICDNLL TCVIRAWDLNKPLLFCPAMNTAMWEHPLTAQQVAQLKAFGYVEIPCVSK

KLVCGDQG GLGAMAEVETIVAKVQAVLSQHGSIQQS

For any suggestions or comments, please send an email to unitrap@crg.es