Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000063870 (Chd4)
Chromosomal location
Chr 6: 125045999 - 125080609 (+)
Description
chromodomain helicase DNA binding protein 4 Gene [Source:MGI (curated);Acc:Chd4-002]
RefSeq_dna
NM_145979 
RefSeq_peptide
NP_666091.1 
UniGene
Mm.475105 Mm.333388 
MGI
MGI:1344380 
Uniprot/SWISSPROT
Q6PDQ2 
Uniprot/SPTREMBL
Q3U582 Q3UFM8 Q5DTP7 Q6IQY9 Q8BM83 Q99JM0 Q9CTT2 Q3ULG0 Q3V265 Q3V3I7 
Human Ortholog
ENSG00000111642 (CHD4)
Omim not available
UniTrap UNI12070
Vector Insertion
Chr 6: 125046180 - 125046279
Public Clones W211D08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18800
Vector Insertion
Chr 6: 125046279 - 125047104
Public Clones not available
Private Clones OST413999 (lexicon) OST357528 (lexicon) OST345819 (lexicon) OST341140 (lexicon)
OST306677 (lexicon) OST211121 (lexicon) OST179262 (lexicon) OST173413 (lexicon)
OST52644 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14806
Vector Insertion
Chr 6: 125047284 - 125050485
Public Clones PST9599-NR (escells) PST14653-NR (escells) PST2452-NR (escells) PST13818-NR (escells)
PST11317-NR (escells) PST13583-NL (escells) PST3703-NR (escells) PST10192-NR (escells)
PST10004-NR (escells) PST13922-NL (escells)
Private Clones OST315260 (lexicon) OST140186 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25034
Vector Insertion
Chr 6: 125050795 - 125051012
Public Clones not available
Private Clones OST197619 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8536
Vector Insertion
Chr 6: 125051713 - 125051899
Public Clones RRO120 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9759
Vector Insertion
Chr 6: 125052317 - 125052488
Public Clones XG587 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37523
Vector Insertion
Chr 6: 125064485 - 125070222
Public Clones PST16156-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15285
Vector Insertion
Chr 6: 125072974 - 125073357
Public Clones PST11341-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3289
Vector Insertion
Chr 6: 125073700 - 125078809
Public Clones AE0399 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 94% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24448
Vector Insertion
Chr 6: 125079837 - 125080604
Public Clones not available
Private Clones OST220218 (lexicon)
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112390
Sequence
CCGGAGCCGGAGCCATTTTCCCCCCTTCGGCCGCGGCGAGGAGGAGCTGGAGCGGGAGTGACACCGGCGAGACCCAGCGCGACCTGAGGCGGCTCTAGG 

- UNI12070 - - UNI18800 - TGACTCGGGCCAGTGCAGAGGGCCCCAGGCCGCAGGCAGGAGCAGCTGGGCCAATTCCCTGGCCGGGGAACGGA

AGGGGATGGCGTCGGGCCTGGGCTCCCCGTCCCCCTGCTCAGCGGGCAGTGAGGAGGAGGATATGGACGCACTTCTGAACAACAGCCTGCCCCCACCCCA

TCCAG - UNI14806 - AAAATGAGGAAGACCCAGACGAGGATTTATCCGAAGCAGAGACTCCAAAGCTCAAGAAGAAGAAAAAGCCTAAGAAACCTC

GAGACCCTAAAATCCCTAAGAGCAAGCGCCAAAAAAAGGAG - UNI25034 - CGTTTACTCTTATGCCGGCAGCTGGGGGACAGCTCTGGGGAGGGG

CCAGAGTTTGTGGAGGAGGAGGAAGAGGTGGCTCTGCGCTCAGACAGTGAGGGCAGCGACTATACTCCTGGCAAGAAGAAGAAAAAGAAGCTCGGACCTA

AGAAAGAGAAGAAGAGCAAATCCAAGCGGAAGGAGGAGGAGGAAGAGGAGGACGAGGATGATGACTCGAAG - UNI25034 - GAACCTAAGTCATCA

GCCCAGCTTTTAGAAGACTGGGGTATGGAAGACATCGACCATGTGTTCTCAGAGGAGGATTATCGGACCCTCACCAACTACAAGGCCTTCAGCCAATTTG

TTAG ACCCCTGATTGCTGCTAAAAACCCCAAGATTGCTGTCTCCAAGATGATGATGGTCTTGGGTGCAAAGTGGAGGGAATTCAGTACCAACAACCCCT

TCAAGGGCAGCTCCGGAGCATCAGTGGCAGCTGCGGCGGCGGCGGCTGTGGCTGTGGTTGAGAGCATGGTGACAGCTACTGAAGTCGCCCCTCCCCCTCC

CCCTGTGGAGGTGCCGATCCGCAAGGCCAAGACCAAGGAGGGCAAAG - UNI8536 - GTCCCAATGCTCGGAGGAAGCCGAAAGGCAGCCCGCGAGT

GCCTGACGCCAAGAAGCCCAAACCCAAGAAAGTAGCTCCTCTGAAGATCAAGCTGGGAGGGTTCGGCTCCAAGCGGAAGAGATCCTCG AGTGAGGACGA

CGATTTAGATGTAGAGTCTGACTTCGACGATGCCAGTATCAACAGCTATTCTGTTTCGGATGGTTCCACCAGCCGCAGTAGTCGGAGCCGTAAGAAACTC

CGGACCGCTAAAAAGAAAAAGAAAG - UNI9759 - GCGAGGAGGAGGTGACTGCTGTGGATGGTTATGAGACAGACCACCAGGACTATTGCGAGGTG

TGCCAGCAAGGCGGCGAGATCATCCTGTGTGATACCTGTCCCCGAGCCTACCATATGGTGTGCCTGGACCCAGACATGGAGAAGGCCCCGGAGGGCAAGT

GGAGCTGTCCGCACTGT GAGAAGGAGGGGATCCAGTGGGAAGCTAAGGAGGACAATTCTGAGGGTGAGGAGATTCTGGAAGAAGTCGGGGGGGACCCAG

AAGAGGAGGATGACCATCACATGGAATTCTGTCGCGTCTGCAAGGACGGCGGGGAGCTCCTGTGCTGTGACACATGCCCTTCTTCCTACCACATCCACTG

CCTGAACCCCCCGCTGCCAGAGATCCCAAACGGCGAATGGCTCTGTCCCCGCTGTACT TGTCCAGCTCTTAAGGGCAAAGTGCAGAAGATCCTAATTTG

GAAGTGGGGCCAGCCACCGTCTCCCACACCAGTGCCTCGGCCTCCAGATGCTGACCCTAATACCCCGTCGCCCAAGCCCTTGGAGGGGCGGCCAGAGAGG

CAGTTCTTTGTGAAATGGCAAGGCATGTCTTACTGGCACTGCTCCTGGGTGTCAGAACTGCAG TTGGAGCTGCACTGTCAGGTGATGTTCAGAAACTAC

CAGCGGAAGAATGATATGGACGAGCCGCCTTCTGGGGACTTTGGTGGAGATGAAGAGAAGAGCCGGAAGCGAAAGAACAAGGACCCTAAGTTTGCAGAGA

TGGAAGAGCGCTTCTACCGCTATGGAATAAAACCGGAGTGGATGATGATCCACCGCATCCTCAACCACAG TGTGGACAAGAAGGGCCACGTTCACTATT

TAATCAAGTGGCGAGACCTGCCCTATGACCAGGCGTCCTGGGAGAGCGAGGACGTGGAGATTCAGGACTACGACCTGTTCAAGCAGAGCTACTGGAACCA

CAG GGAGTTAATGAGGGGTGAAGAAGGACGACCCGGCAAGAAGCTTAAGAAGGTGAAGCTACGGAAACTGGAAAGGCCTCCGGAGACCCCAACTGTTGA

T CCCACCGTGAAGTATGAGCGACAGCCGGAGTATCTGGATGCGACGGGTGGAACCCTGCATCCCTACCAAATGGAAGGCTTAAACTGGCTCCGCTTCTC

CTGGGCTCAGGGAACCGATACTATCTTGGCTGATGAGATGGGCCTTGGGAAAACTGTGCAGACAGCAGTCTTCCTCTACTCCCTCTATAAGGAG GGTCA

CTCCAAAGGCCCCTTCTTAGTGAGCGCTCCTCTGTCCACCATCATCAACTGGGAGAGAGAGTTTGAGATGTGGGCTCCTGATATGTATGTGGTAACCTAT

GTGGGTGACAAGGACAGCCGTGCCATCATCCGGGAAAATGAGTTCTCCTTTGAAGACAATGCCATTCGTGGTGGCAAGAAGGCCTCGAGGATGAAG AAA

GAAGCATCGGTGAAATTCCATGTTCTGCTGACATCCTATGAGTTGATCACCATTGATATGGCCATCTTGGGTTCTATTGACTGGGCCTGCCTCATTGTGG

ATGAAGCCCATCGGCTGAAGAACAACCAGTCTAAG TTCTTTCGAGTTTTGAATGGTTACTCACTCCAGCACAAGCTGTTGCTAACTGGAACTCCGTTAC

AGAACAATCTAGAGGAACTGTTTCATCTGCTCAACTTTCTCACCCCTGAGAGGTTCCA CAACTTAGAAGGCTTCTTGGAGGAGTTTGCAGACATTGCCA

AAGAGGACCAGATTAAAAAACTCCACGACATGCTGGGGCCTCATATGTTGCGGCGGCTCAAAGCTGACGTCTTCAAGAATATGCCATCCAAGACAGAGCT

GATTGTGCGCGTGGAGTTGAGTCCTATGCAGAA GAAGTACTACAAGTATATTCTCACGCGGAATTTCGAAGCACTTAATGCTCGAGGTGGTGGCAACCA

GGTTTCTCTGCTGAACGTGGTGATGGATCTTAAGAAATGCTGCAACCACCCTTATCTCTTCCCTGTGGCAGCAATG GAAGCCCCTAAGATGCCTAATGG

TATGTATGATGGCAGTGCCCTAATCAGAGCATCTGGGAAGTTGTTGCTGCTGCAGAAGATGCTTAAGAACCTGAAAGAGGGAGGGCATCGTGTGCTCATC

TTCTCCCAG ATGACCAAGATGTTGGACTTGCTAGAGGATTTTTTAGAACATGAAGGTTATAAATATGAACGTATTGATGGTGGAATCACTGGGAACATG

CGTCAGGAGGCCATTGATCGCTTCAATG CACCGGGTGCTCAACAGTTCTGCTTCTTGCTTTCCACTCGAGCTGGGGGCCTTGGGATCAATCTGGCCACT

GCGGACACAGTTATTATATATGACTCTGACTGGAACCCCCATAATGACATCCAG GCCTTTAGCAGAGCCCACCGTATTGGGCAAAATAAGAAGGTGATG

ATCTACCGGTTTGTGACCCGTGCATCAGTGGAGGAGCGCATCACGCAGGTGGCAAAGAAGAAGATGATGCTGACACATTTAGTGGTACGGCCTGGCCTGG

GCTCCAAGACAGGCTCAATGTCTAAACAGGAGCTTGATGATATCCTCAAATTTGGCACTGAGGAGCTATTCAAGGATGAAGCCACGGATGGAG GAGGAG

ACAACAAGGAGGGAGAAGACAGCAGTGTTATCCACTATGACGATAAGGCCATTGAACGACTGCTGGATCGAAACCAGGATGAGACTGAAGACACAGAATT

GCAGGGCATGAATGAATATTTGAGCTCATTCAAAGTGGCTCAGTATGTGGTACGGGAAGAAGAGATGGGG GAGGAAGAGGAGGTAGAACGGGAAATCAT

AAAACAGGAAGAAAGTGTGGATCCTGACTACTGGGAGAAATTGCTGCGGCACCATTATGAGCAGCAGCAAGAAGATCTAGCCCGAAATCTGGGCAAAGGA

AAAAGAATCCGTAAACAGGTCAACTACAATGATGGCTCACAGGAGGACCGAG ATTGGCAGGACGACCAGTCCGACAACCAGTCCGATTACTCAGTGGCC

TCAGAGGAAGGTGATGAAGACTTTGACGAACGGTCAGAAG CTCCCCGCAGGCCCAGTCGCAAGGGCCTGCGGAATGATAAAGATAAGCCATTACCTCCT

CTGTTGGCCCGTGTTGGTGGGAATATTGAA GTACTTGGTTTTAATGCTCGTCAGCGAAAAGCATTTCTTAATGCAATTATGCGATATGGCATGCCACCT

CAGGATGCTTTTACCACTCAGTGGCTTGTGAGAGATCTTCGAGGCAAGTCAGAGAAAGAATTTAA GGCTTATGTGTCACTCTTCATGCGACATTTGTGT

GAGCCTGGGGCAGATGGGGCTGAGACCTTTGCTGATGGCGTCCCACGAGAAGGCCTGTCTCGTCAACATGTTCTCACTAGGATCGGTGTCATGTCTCTGA

TTCGAAAGAAG GTTCAGGAGTTTGAACATGTTAATGGACGCTGGAGCATGCCCGAACTGGCTGAAGTAGAGGAAAACAAAAAAATGTCTCAGCCAGGTT

CACCTTCTCCAAAGACTCCTACACCTTCCACACCAGGGGACACACAACCCAATACTCCTGCGCCTGTGCCACCTGCTG AGGATGGGATAAAAATAGAGG

AAAATAGCCTTAAAGAAGAAGAGAGCACAGAAGGAGAGAAGGAAGTTAAATCTACAGCCCCTGAGGCGACTGTGGAG TGTGCACAGCCCCCTGCCCCTG

CCCCTGCCACTGCCCCTGCCACTGCCACTGCCCCTGAGGATGACAAGGCTCCTGCTGAGCCTCCTGAGGGGGAGGAAAAAGTGGAAAAGGCAGAGGTGAA

GGAGAGAACAGAGGAGCCTATGGAGACAGAGGCCAAAG GTACTACTGAGGTGGAGAAAGTGGAGGAGAAGTCTGCGGTAGACCTGACCCCGATCGTGGT

GGAAGACAAAG AAGAGAAGAAGGAGGAGGAGGAGAAAAAGGACGTGATGCTTCAGAATGGAGAAACTCCCAAGGATCTTAGTGATGAGAAGCAGAAGAA

AAACAGCAAACAGCGTTTCATGTTCAACATTGCAGATGGTGGTTTTACTG - UNI15285 - AGTTGCACTCACTGTGGCAGAATGAAGAGCGGGCAG

CCACAGTCACTAAGAAGACTTACGAGATCTGGCACCGTCGCCATGATTACTGGCTGCTGGCTGGCATTATAAA CCACGGCTATGCCCGGTGGCAGGACA

TCCAGAATGACCCACGGTATGCCATCCTCAATGAGCCTTTCAAGGGTGAAATGAATCGTGGCAATTTTCTAGAGATCAAGAATAAATTTTTAGCTCGAAG

ATTCAAG - UNI3289 - CTCTTAGAACAAGCCCTGGTGATCGAGGAGCAGCTTCGCAGGGCAGCTTACCTGAACATGTCCGAGGACCCCTCTCACCC

GTCTATGGCCCTTAACACCCGCTTCGCTGAGGTGGAGTGTTTGGCAGAAAGTCACCAGCACCTGTCCAAGGAGTCGATGGCAGGGAATAAGCCGGCCAAT

GCAGTCCTACACAAAG - UNI24448 - TCCTGAAACAGCTGGAGGAACTGTTGAGTGACATGAAAGCTGATGTGACGCGGCTCCCAGCCACCATTGC

CCGCATCCCCCCAGTCGCTGTGAGGTTACAGATGTCAGAGCGGAACATTCTCAGCCGCCTGGCAAACAGGGCGCCAGAACCTCCCCCACAGCAGGTAGCC

CAGCAGCAGTGAAAGACCCAGAGTGATATCCACCTCCACCACTCAGCAGTGACCTTCCTCACTTTCTCTTGTCCCGGCTGCCCCTGGGGGCCAGAGAGAC

CCTTGCCTTCCTTCTGCCCATCTTCTGAGTTGTAAAGGAACAGCCCTGCGCAGTGGGGCAGGGAGGGAGGGAGAAGCAATGGTGCCCTTCCTGCTGGAGA

GACAAGCAGCAGTAGCGCAGCGCCCGCCCGCCATGTGCAGGAGCTGGCGGGCTGGCTGCCTTCTGGACCCTGGCTTCTCCCCACCGTGCGCCTGTTACAA

ACTGTTGTGGATTCTGCCAGGCTCGAAGAAAATGATCTGAATTTCTTCCTCTTTTTGGTTTTATTTTGTTGGTTTACTTTGTGTTTTCTCCTTTTTGGGG

GGTATTCAGAGTGGGCCGGGCCCCTGGGCGAGACACAGCTACCTCTGTTGGCATCTTTTTAATACCAGGAACCCAGCGGCTCCAGCCACTGAGCAGCTAA

ATAAAGTTGGAAAAAAAAAAAAAAAGAAAAAGAACCAAAAGCATAAAAAACCACAGCAAATTTCTTGATGAGAACTGAAAATAAAAGTTTCCTTGTATTT

TA
Translation
 - UNI12070 - - UNI18800 - MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPE - UNI14806 - ENEEDPDEDLSEAETPKLKKKKKPK

KPRDPKIPKSKRQKKE - UNI25034 - RLLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEEDEDDD

SK - UNI25034 - EPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVR RPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGASVAA

AAAAAVAVVESMVTATEVAPPPPPVEVPIRKAKTKEGKG - UNI8536 - GPNARRKPKGSPRVPDAKKPKPKKVAPLKIKLGGFGSKRKRSS SEDD

DLDVESDFDDASINSYSVSDGSTSRSSRSRKKLRTAKKKKKG - UNI9759 - GEEEVTAVDGYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDP

DMEKAPEGKWSCPHC EKEGIQWEAKEDNSEGEEILEEVGGDPEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCT CPA

LKGKVQKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSELQ LELHCQVMFRNYQRKNDMDEPPSGDFGGDEEKSR

KRKNKDPKFAEMEERFYRYGIKPEWMMIHRILNHS SVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDLFKQSYWNHR RELMRGEEGRPGKKLKKV

KLRKLERPPETPTVD PTVKYERQPEYLDATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKE GHSKGPFLVSAPLSTIINW

EREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMK KEASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSK FFRV

LNGYSLQHKLLLTGTPLQNNLEELFHLLNFLTPERFH HNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQK KK

YYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAM EAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQ MTKMLDLL

EDFLEHEGYKYERIDGGITGNMRQEAIDRFNA APGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQ AFSRAHRIGQNKKVMIYRFVTRAS

VEERITQVAKKKMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDEATDGG GGDNKEGEDSSVIHYDDKAIERLLDRNQDETEDTELQGMNEYL

SSFKVAQYVVREEEMG EEEEVEREIIKQEESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRD DWQDDQSDNQSDYSVASEEGD

EDFDERSEA APRRPSRKGLRNDKDKPLPPLLARVGGNIE VLGFNARQRKAFLNAIMRYGMPPQDAFTTQWLVRDLRGKSEKEFK KAYVSLFMRHLCE

PGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKK VQEFEHVNGRWSMPELAEVEENKKMSQPGSPSPKTPTPSTPGDTQPNTPAPVPPAE EDGIKI

EENSLKEEESTEGEKEVKSTAPEATVE CAQPPAPAPATAPATATAPEDDKAPAEPPEGEEKVEKAEVKERTEEPMETEAKG GTTEVEKVEEKSAVDLT

PIVVEDKE EEKKEEEEKKDVMLQNGETPKDLSDEKQKKNSKQRFMFNIADGGFTE - UNI15285 - ELHSLWQNEERAATVTKKTYEIWHRRHDYW

LLAGIIN NHGYARWQDIQNDPRYAILNEPFKGEMNRGNFLEIKNKFLARRFK - UNI3289 - LLEQALVIEEQLRRAAYLNMSEDPSHPSMALNTR

FAEVECLAESHQHLSKESMAGNKPANAVLHKV - UNI24448 - VLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLANRAPEPPPQ

QVAQQQ
Transcript ENSMUST00000112392
Sequence
GTGGCCAATGGTTGCCTGAGCGACGAGGGGGCGGGGGTTGCCCGGGAGACCTAAAGAGGAGGGTGGCGGTAGTGGAGGGGGGGGTTGGAGTTGGTTGAGG

TTATTATGGGCTGTCCGTGGGGGGCGGGGCCTGTGCGGTGGGATTTCCCGGCCGGTGTTTCGGGCCCTTTAAGAGGCGACGCCGGAGCCGGAGCCATTTT

CCCCCCTTCGGCCGCGGCGAGGAGGAGCTGGAGCGGGAGTGACACCGGCGAGACCCAGCGCGACCTGAGGCGGCTCTAGG - UNI12070 - - UNI1

8800 - TGACTCGGGCCAGTGCAGAGGGCCCCAGGCCGCAGGCAGGAGCAGCTGGGCCAATTCCCTGGCCGGGGAACGGAAGGGGATGGCGTCGGGCCT

GGGCTCCCCGTCCCCCTGCTCAGCGGGCAGTGAGGAGGAGGATATGGACGCACTTCTGAACAACAGCCTGCCCCCACCCCATCCAG - UNI14806 - 

AAAATGAGGAAGACCCAGACGAGGATTTATCCGAAGCAGAGACTCCAAAGCTCAAGAAGAAGAAAAAGCCTAAGAAACCTCGAGACCCTAAAATCCCTAA

GAGCAAGCGCCAAAAAAAGGAG - UNI25034 - CTGGGGGACAGCTCTGGGGAGGGGCCAGAGTTTGTGGAGGAGGAGGAAGAGGTGGCTCTGCGCT

CAGACAGTGAGGGCAGCGACTATACTCCTGGCAAGAAGAAGAAAAAGAAGCTCGGACCTAAGAAAGAGAAGAAGAGCAAATCCAAGCGGAAGGAGGAGGA

GGAAGAGGAGGACGAGGATGATGACTCGAAG - UNI25034 - GAACCTAAGTCATCAGCCCAGCTTTTAGAAGACTGGGGTATGGAAGACATCGACC

ATGTGTTCTCAGAGGAGGATTATCGGACCCTCACCAACTACAAGGCCTTCAGCCAATTTGTTAG ACCCCTGATTGCTGCTAAAAACCCCAAGATTGCTG

TCTCCAAGATGATGATGGTCTTGGGTGCAAAGTGGAGGGAATTCAGTACCAACAACCCCTTCAAGGGCAGCTCCGGAGCATCAGTGGCAGCTGCGGCGGC

GGCGGCTGTGGCTGTGGTTGAGAGCATGGTGACAGCTACTGAAGTCGCCCCTCCCCCTCCCCCTGTGGAGGTGCCGATCCGCAAGGCCAAGACCAAGGAG

GGCAAAG - UNI8536 - GTCCCAATGCTCGGAGGAAGCCGAAAGGCAGCCCGCGAGTGCCTGACGCCAAGAAGCCCAAACCCAAGAAAGTAGCTCCT

CTGAAGATCAAGCTGGGAGGGTTCGGCTCCAAGCGGAAGAGATCCTCG AGTGAGGACGACGATTTAGATGTAGAGTCTGACTTCGACGATGCCAGTATC

AACAGCTATTCTGTTTCGGATGGTTCCACCAGCCGCAGTAGTCGGAGCCGTAAGAAACTCCGGACCGCTAAAAAGAAAAAGAAAG - UNI9759 - AC

CACCAGGACTATTGCGAGGTGTGCCAGCAAGGCGGCGAGATCATCCTGTGTGATACCTGTCCCCGAGCCTACCATATGGTGTGCCTGGACCCAGACATGG

AGAAGGCCCCGGAGGGCAAGTGGAGCTGTCCGCACTGT GAGAAGGAGGGGATCCAGTGGGAAGCTAAGGAGGACAATTCTGAGGGTGAGGAGATTCTGG

AAGAAGTCGGGGGGGACCCAGAAGAGGAGGATGACCATCACATGGAATTCTGTCGCGTCTGCAAGGACGGCGGGGAGCTCCTGTGCTGTGACACATGCCC

TTCTTCCTACCACATCCACTGCCTGAACCCCCCGCTGCCAGAGATCCCAAACGGCGAATGGCTCTGTCCCCGCTGTACT TGTCCAGCTCTTAAGGGCAA

AGTGCAGAAGATCCTAATTTGGAAGTGGGGCCAGCCACCGTCTCCCACACCAGTGCCTCGGCCTCCAGATGCTGACCCTAATACCCCGTCGCCCAAGCCC

TTGGAGGGGCGGCCAGAGAGGCAGTTCTTTGTGAAATGGCAAGGCATGTCTTACTGGCACTGCTCCTGGGTGTCAGAACTGCAG TTGGAGCTGCACTGT

CAGGTGATGTTCAGAAACTACCAGCGGAAGAATGATATGGACGAGCCGCCTTCTGGGGACTTTGGTGGAGATGAAGAGAAGAGCCGGAAGCGAAAGAACA

AGGACCCTAAGTTTGCAGAGATGGAAGAGCGCTTCTACCGCTATGGAATAAAACCGGAGTGGATGATGATCCACCGCATCCTCAACCACAG TGTGGACA

AGAAGGGCCACGTTCACTATTTAATCAAGTGGCGAGACCTGCCCTATGACCAGGCGTCCTGGGAGAGCGAGGACGTGGAGATTCAGGACTACGACCTGTT

CAAGCAGAGCTACTGGAACCACAG GGAGTTAATGAGGGGTGAAGAAGGACGACCCGGCAAGAAGCTTAAGAAGGTGAAGCTACGGAAACTGGAAAGGCC

TCCGGAGACCCCAACTGTTGAT CCCACCGTGAAGTATGAGCGACAGCCGGAGTATCTGGATGCGACGGGTGGAACCCTGCATCCCTACCAAATGGAAGG

CTTAAACTGGCTCCGCTTCTCCTGGGCTCAGGGAACCGATACTATCTTGGCTGATGAGATGGGCCTTGGGAAAACTGTGCAGACAGCAGTCTTCCTCTAC

TCCCTCTATAAGGAG GGTCACTCCAAAGGCCCCTTCTTAGTGAGCGCTCCTCTGTCCACCATCATCAACTGGGAGAGAGAGTTTGAGATGTGGGCTCCT

GATATGTATGTGGTAACCTATGTGGGTGACAAGGACAGCCGTGCCATCATCCGGGAAAATGAGTTCTCCTTTGAAGACAATGCCATTCGTGGTGGCAAGA

AGGCCTCGAGGATGAAG AAAGAAGCATCGGTGAAATTCCATGTTCTGCTGACATCCTATGAGTTGATCACCATTGATATGGCCATCTTGGGTTCTATTG

ACTGGGCCTGCCTCATTGTGGATGAAGCCCATCGGCTGAAGAACAACCAGTCTAAG TTCTTTCGAGTTTTGAATGGTTACTCACTCCAGCACAAGCTGT

TGCTAACTGGAACTCCGTTACAGAACAATCTAGAGGAACTGTTTCATCTGCTCAACTTTCTCACCCCTGAGAGGTTCCA CAACTTAGAAGGCTTCTTGG

AGGAGTTTGCAGACATTGCCAAAGAGGACCAGATTAAAAAACTCCACGACATGCTGGGGCCTCATATGTTGCGGCGGCTCAAAGCTGACGTCTTCAAGAA

TATGCCATCCAAGACAGAGCTGATTGTGCGCGTGGAGTTGAGTCCTATGCAGAA GAAGTACTACAAGTATATTCTCACGCGGAATTTCGAAGCACTTAA

TGCTCGAGGTGGTGGCAACCAGGTTTCTCTGCTGAACGTGGTGATGGATCTTAAGAAATGCTGCAACCACCCTTATCTCTTCCCTGTGGCAGCAATG GA

AGCCCCTAAGATGCCTAATGGTATGTATGATGGCAGTGCCCTAATCAGAGCATCTGGGAAGTTGTTGCTGCTGCAGAAGATGCTTAAGAACCTGAAAGAG

GGAGGGCATCGTGTGCTCATCTTCTCCCAG ATGACCAAGATGTTGGACTTGCTAGAGGATTTTTTAGAACATGAAGGTTATAAATATGAACGTATTGAT

GGTGGAATCACTGGGAACATGCGTCAGGAGGCCATTGATCGCTTCAATG CACCGGGTGCTCAACAGTTCTGCTTCTTGCTTTCCACTCGAGCTGGGGGC

CTTGGGATCAATCTGGCCACTGCGGACACAGTTATTATATATGACTCTGACTGGAACCCCCATAATGACATCCAG GCCTTTAGCAGAGCCCACCGTATT

GGGCAAAATAAGAAGGTGATGATCTACCGGTTTGTGACCCGTGCATCAGTGGAGGAGCGCATCACGCAGGTGGCAAAGAAGAAGATGATGCTGACACATT

TAGTGGTACGGCCTGGCCTGGGCTCCAAGACAGGCTCAATGTCTAAACAGGAGCTTGATGATATCCTCAAATTTGGCACTGAGGAGCTATTCAAGGATGA

AGCCACGGATGGAG GAGGAGACAACAAGGAGGGAGAAGACAGCAGTGTTATCCACTATGACGATAAGGCCATTGAACGACTGCTGGATCGAAACCAGGA

TGAGACTGAAGACACAGAATTGCAGGGCATGAATGAATATTTGAGCTCATTCAAAGTGGCTCAGTATGTGGTACGGGAAGAAGAGATGGGG GAGGAAGA

GGAGGTAGAACGGGAAATCATAAAACAGGAAGAAAGTGTGGATCCTGACTACTGGGAGAAATTGCTGCGGCACCATTATGAGCAGCAGCAAGAAGATCTA

GCCCGAAATCTGGGCAAAGGAAAAAGAATCCGTAAACAGGTCAACTACAATGATGGCTCACAGGAGGACCGAG ATTGGCAGGACGACCAGTCCGACAAC

CAGTCCGATTACTCAGTGGCCTCAGAGGAAGGTGATGAAGACTTTGACGAACGGTCAGAAG CTCCCCGCAGGCCCAGTCGCAAGGGCCTGCGGAATGAT

AAAGATAAGCCATTACCTCCTCTGTTGGCCCGTGTTGGTGGGAATATTGAA GTACTTGGTTTTAATGCTCGTCAGCGAAAAGCATTTCTTAATGCAATT

ATGCGATATGGCATGCCACCTCAGGATGCTTTTACCACTCAGTGGCTTGTGAGAGATCTTCGAGGCAAGTCAGAGAAAGAATTTAA GGCTTATGTGTCA

CTCTTCATGCGACATTTGTGTGAGCCTGGGGCAGATGGGGCTGAGACCTTTGCTGATGGCGTCCCACGAGAAGGCCTGTCTCGTCAACATGTTCTCACTA

GGATCGGTGTCATGTCTCTGATTCGAAAGAAG GTTCAGGAGTTTGAACATGTTAATGGACGCTGGAGCATGCCCGAACTGGCTGAAGTAGAGGAAAACA

AAAAAATGTCTCAGCCAGGTTCACCTTCTCCAAAGACTCCTACACCTTCCACACCAGGGGACACACAACCCAATACTCCTGCGCCTGTGCCACCTGCTG 

AGGATGGGATAAAAATAGAGGAAAATAGCCTTAAAGAAGAAGAGAGCACAGAAGGAGAGAAGGAAGTTAAATCTACAGCCCCTGAGGCGACTGTGGAG T

GTGCACAGCCCCCTGCCCCTGCCCCTGCCACTGCCCCTGCCACTGCCACTGCCCCTGAGGATGACAAGGCTCCTGCTGAGCCTCCTGAGGGGGAGGAAAA

AGTGGAAAAGGCAGAGGTGAAGGAGAGAACAGAGGAGCCTATGGAGACAGAGGCCAAAG GTACTACTGAGGTGGAGAAAGTGGAGGAGAAGTCTGCGGT

AGACCTGACCCCGATCGTGGTGGAAGACAAAG AAGAGAAGAAGGAGGAGGAGGAGAAAAAGGACGTGATGCTTCAGAATGGAGAAACTCCCAAGGATCT

TAGTGATGAGAAGCAGAAGAAAAACAGCAAACAGCGTTTCATGTTCAACATTGCAGATGGTGGTTTTACTG - UNI15285 - AGTTGCACTCACTGT

GGCAGAATGAAGAGCGGGCAGCCACAGTCACTAAGAAGACTTACGAGATCTGGCACCGTCGCCATGATTACTGGCTGCTGGCTGGCATTATAAA CCACG

GCTATGCCCGGTGGCAGGACATCCAGAATGACCCACGGTATGCCATCCTCAATGAGCCTTTCAAGGGTGAAATGAATCGTGGCAATTTTCTAGAGATCAA

GAATAAATTTTTAGCTCGAAGATTCAAG - UNI3289 - CTCTTAGAACAAGCCCTGGTGATCGAGGAGCAGCTTCGCAGGGCAGCTTACCTGAACAT

GTCCGAGGACCCCTCTCACCCGTCTATGGCCCTTAACACCCGCTTCGCTGAGGTGGAGTGTTTGGCAGAAAGTCACCAGCACCTGTCCAAGGAGTCGATG

GCAGGGAATAAGCCGGCCAATGCAGTCCTACACAAAG - UNI24448 - TCCTGAAACAGCTGGAGGAACTGTTGAGTGACATGAAAGCTGATGTGAC

GCGGCTCCCAGCCACCATTGCCCGCATCCCCCCAGTCGCTGTGAGGTTACAGATGTCAGAGCGGAACATTCTCAGCCGCCTGGCAAACAGGGCGCCAGAA

CCTCCCCCACAGCAGGTAGCCCAGCAGCAGTGAAAGACCCAGAGTGATATCCACCTCCACCACTCAGCAGTGACCTTCCTCACTTTCTCTTGTCCCGGCT

GCCCCTGGGGGCCAGAGAGACCCTTGCCTTCCTTCTGCCCATCTTCTGAGTTGTAAAGGAACAGCCCTGCGCAGTGGGGCAGGGAGGGAGGGAGAAGCAA

TGGTGCCCTTCCTGCTGGAGAGACAAGCAGCAGTAGCGCAGCGCCCGCCCGCCATGTGCAGGAGCTGGCGGGCTGGCTGCCTTCTGGACCCTGGCTTCTC

CCCACCGTGCGCCTGTTACAAACTGTTGTGGATTCTGCCAGGCTCGAAGAAAATGATCTGAATTTCTTCCTCTTTTTGGTTTTATTTTGTTGGTTTACTT

TGTGTTTTCTCCTTTTTGGGGGGTATTCAGAGTGGGCCGGGCCCCTGGGCGAGACACAGCTACCTCTGTTGGCATCTTTTTAATACCAGGAACCCAGCGG

CTCCAGCCACTGAGCAGCTAAATAAAGTTGGAAAAAAAAAAAAAAAGAAAAAGAACCAAAAGCATAAAAAACCACAGCAAATTTCTTGATGAGAACTGAA

AATAAAAGTTTCCTTGT
Translation
 - UNI12070 - - UNI18800 - MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPE - UNI14806 - ENEEDPDEDLSEAETPKLKKKKKPK

KPRDPKIPKSKRQKKE - UNI25034 - LGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEEDEDDDSK - UN

I25034 - EPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVR RPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGASVAAAAAAAVA

VVESMVTATEVAPPPPPVEVPIRKAKTKEGKG - UNI8536 - GPNARRKPKGSPRVPDAKKPKPKKVAPLKIKLGGFGSKRKRSS SEDDDLDVESD

FDDASINSYSVSDGSTSRSSRSRKKLRTAKKKKKD - UNI9759 - DHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHC EKEG

IQWEAKEDNSEGEEILEEVGGDPEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCT CPALKGKVQKILIWKWGQPPSPT

PVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSELQ LELHCQVMFRNYQRKNDMDEPPSGDFGGDEEKSRKRKNKDPKFAEMEERFYRYG

IKPEWMMIHRILNHS SVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDLFKQSYWNHR RELMRGEEGRPGKKLKKVKLRKLERPPETPTVD PTVK

YERQPEYLDATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKE GHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDK

DSRAIIRENEFSFEDNAIRGGKKASRMK KEASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSK FFRVLNGYSLQHKLLLTGTPLQNN

LEELFHLLNFLTPERFH HNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQK KKYYKYILTRNFEALNARGGGN

QVSLLNVVMDLKKCCNHPYLFPVAAM EAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQ MTKMLDLLEDFLEHEGYKYERIDGGITG

NMRQEAIDRFNA APGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQ AFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVV

RPGLGSKTGSMSKQELDDILKFGTEELFKDEATDGG GGDNKEGEDSSVIHYDDKAIERLLDRNQDETEDTELQGMNEYLSSFKVAQYVVREEEMG EEE

EVEREIIKQEESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRD DWQDDQSDNQSDYSVASEEGDEDFDERSEA APRRPSRKGL

RNDKDKPLPPLLARVGGNIE VLGFNARQRKAFLNAIMRYGMPPQDAFTTQWLVRDLRGKSEKEFK KAYVSLFMRHLCEPGADGAETFADGVPREGLSR

QHVLTRIGVMSLIRKK VQEFEHVNGRWSMPELAEVEENKKMSQPGSPSPKTPTPSTPGDTQPNTPAPVPPAE EDGIKIEENSLKEEESTEGEKEVKST

APEATVE CAQPPAPAPATAPATATAPEDDKAPAEPPEGEEKVEKAEVKERTEEPMETEAKG GTTEVEKVEEKSAVDLTPIVVEDKE EEKKEEEEKKD

VMLQNGETPKDLSDEKQKKNSKQRFMFNIADGGFTE - UNI15285 - ELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAGIIN NHGYARWQDIQN

DPRYAILNEPFKGEMNRGNFLEIKNKFLARRFK - UNI3289 - LLEQALVIEEQLRRAAYLNMSEDPSHPSMALNTRFAEVECLAESHQHLSKESMA

GNKPANAVLHKV - UNI24448 - VLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLANRAPEPPPQQVAQQQ
Transcript ENSMUST00000056889
Sequence
CGGAGCCGGAGCCATTTTCCCCCCTTCGGCCGCGGCGAGGAGGAGCTGGAGCGGGAGTGACACCGGCGAGACCCAGCGCGACCTGAGGCGGCTCTAGG -

 UNI12070 - - UNI18800 - TGACTCGGGCCAGTGCAGAGGGCCCCAGGCCGCAGGCAGGAGCAGCTGGGCCAATTCCCTGGCCGGGGAACGGAA

GGGGATGGCGTCGGGCCTGGGCTCCCCGTCCCCCTGCTCAGCGGGCAGTGAGGAGGAGGATATGGACGCACTTCTGAACAACAGCCTGCCCCCACCCCAT

CCAG - UNI14806 - AAAATGAGGAAGACCCAGACGAGGATTTATCCGAAGCAGAGACTCCAAAGCTCAAGAAGAAGAAAAAGCCTAAGAAACCTCG

AGACCCTAAAATCCCTAAGAGCAAGCGCCAAAAAAAGGAG - UNI25034 - CTGGGGGACAGCTCTGGGGAGGGGCCAGAGTTTGTGGAGGAGGAGG

AAGAGGTGGCTCTGCGCTCAGACAGTGAGGGCAGCGACTATACTCCTGGCAAGAAGAAGAAAAAGAAGCTCGGACCTAAGAAAGAGAAGAAGAGCAAATC

CAAGCGGAAGGAGGAGGAGGAAGAGGAGGACGAGGATGATGACTCGAAG - UNI25034 - GAACCTAAGTCATCAGCCCAGCTTTTAGAAGACTGGG

GTATGGAAGACATCGACCATGTGTTCTCAGAGGAGGATTATCGGACCCTCACCAACTACAAGGCCTTCAGCCAATTTGTTAG ACCCCTGATTGCTGCTA

AAAACCCCAAGATTGCTGTCTCCAAGATGATGATGGTCTTGGGTGCAAAGTGGAGGGAATTCAGTACCAACAACCCCTTCAAGGGCAGCTCCGGAGCATC

AGTGGCAGCTGCGGCGGCGGCGGCTGTGGCTGTGGTTGAGAGCATGGTGACAGCTACTGAAGTCGCCCCTCCCCCTCCCCCTGTGGAGGTGCCGATCCGC

AAGGCCAAGACCAAGGAGGGCAAAG - UNI8536 - GTCCCAATGCTCGGAGGAAGCCGAAAGGCAGCCCGCGAGTGCCTGACGCCAAGAAGCCCAAA

CCCAAGAAAGTAGCTCCTCTGAAGATCAAGCTGGGAGGGTTCGGCTCCAAGCGGAAGAGATCCTCG AGTGAGGACGACGATTTAGATGTAGAGTCTGAC

TTCGACGATGCCAGTATCAACAGCTATTCTGTTTCGGATGGTTCCACCAGCCGCAGTAGTCGGAGCCGTAAGAAACTCCGGACCGCTAAAAAGAAAAAGA

AAG - UNI9759 - GCGAGGAGGAGGTGACTGCTGTGGATGGTTATGAGACAGACCACCAGGACTATTGCGAGGTGTGCCAGCAAGGCGGCGAGATCA

TCCTGTGTGATACCTGTCCCCGAGCCTACCATATGGTGTGCCTGGACCCAGACATGGAGAAGGCCCCGGAGGGCAAGTGGAGCTGTCCGCACTGT GAGA

AGGAGGGGATCCAGTGGGAAGCTAAGGAGGACAATTCTGAGGGTGAGGAGATTCTGGAAGAAGTCGGGGGGGACCCAGAAGAGGAGGATGACCATCACAT

GGAATTCTGTCGCGTCTGCAAGGACGGCGGGGAGCTCCTGTGCTGTGACACATGCCCTTCTTCCTACCACATCCACTGCCTGAACCCCCCGCTGCCAGAG

ATCCCAAACGGCGAATGGCTCTGTCCCCGCTGTACT TGTCCAGCTCTTAAGGGCAAAGTGCAGAAGATCCTAATTTGGAAGTGGGGCCAGCCACCGTCT

CCCACACCAGTGCCTCGGCCTCCAGATGCTGACCCTAATACCCCGTCGCCCAAGCCCTTGGAGGGGCGGCCAGAGAGGCAGTTCTTTGTGAAATGGCAAG

GCATGTCTTACTGGCACTGCTCCTGGGTGTCAGAACTGCAG TTGGAGCTGCACTGTCAGGTGATGTTCAGAAACTACCAGCGGAAGAATGATATGGACG

AGCCGCCTTCTGGGGACTTTGGTGGAGATGAAGAGAAGAGCCGGAAGCGAAAGAACAAGGACCCTAAGTTTGCAGAGATGGAAGAGCGCTTCTACCGCTA

TGGAATAAAACCGGAGTGGATGATGATCCACCGCATCCTCAACCACAG TGTGGACAAGAAGGGCCACGTTCACTATTTAATCAAGTGGCGAGACCTGCC

CTATGACCAGGCGTCCTGGGAGAGCGAGGACGTGGAGATTCAGGACTACGACCTGTTCAAGCAGAGCTACTGGAACCACAG GGAGTTAATGAGGGGTGA

AGAAGGACGACCCGGCAAGAAGCTTAAGAAGGTGAAGCTACGGAAACTGGAAAGGCCTCCGGAGACCCCAACTGTTGAT CCCACCGTGAAGTATGAGCG

ACAGCCGGAGTATCTGGATGCGACGGGTGGAACCCTGCATCCCTACCAAATGGAAGGCTTAAACTGGCTCCGCTTCTCCTGGGCTCAGGGAACCGATACT

ATCTTGGCTGATGAGATGGGCCTTGGGAAAACTGTGCAGACAGCAGTCTTCCTCTACTCCCTCTATAAGGAG GGTCACTCCAAAGGCCCCTTCTTAGTG

AGCGCTCCTCTGTCCACCATCATCAACTGGGAGAGAGAGTTTGAGATGTGGGCTCCTGATATGTATGTGGTAACCTATGTGGGTGACAAGGACAGCCGTG

CCATCATCCGGGAAAATGAGTTCTCCTTTGAAGACAATGCCATTCGTGGTGGCAAGAAGGCCTCGAGGATGAAG AAAGAAGCATCGGTGAAATTCCATG

TTCTGCTGACATCCTATGAGTTGATCACCATTGATATGGCCATCTTGGGTTCTATTGACTGGGCCTGCCTCATTGTGGATGAAGCCCATCGGCTGAAGAA

CAACCAGTCTAAG TTCTTTCGAGTTTTGAATGGTTACTCACTCCAGCACAAGCTGTTGCTAACTGGAACTCCGTTACAGAACAATCTAGAGGAACTGTT

TCATCTGCTCAACTTTCTCACCCCTGAGAGGTTCCA CAACTTAGAAGGCTTCTTGGAGGAGTTTGCAGACATTGCCAAAGAGGACCAGATTAAAAAACT

CCACGACATGCTGGGGCCTCATATGTTGCGGCGGCTCAAAGCTGACGTCTTCAAGAATATGCCATCCAAGACAGAGCTGATTGTGCGCGTGGAGTTGAGT

CCTATGCAGAA GAAGTACTACAAGTATATTCTCACGCGGAATTTCGAAGCACTTAATGCTCGAGGTGGTGGCAACCAGGTTTCTCTGCTGAACGTGGTG

ATGGATCTTAAGAAATGCTGCAACCACCCTTATCTCTTCCCTGTGGCAGCAATG GAAGCCCCTAAGATGCCTAATGGTATGTATGATGGCAGTGCCCTA

ATCAGAGCATCTGGGAAGTTGTTGCTGCTGCAGAAGATGCTTAAGAACCTGAAAGAGGGAGGGCATCGTGTGCTCATCTTCTCCCAG ATGACCAAGATG

TTGGACTTGCTAGAGGATTTTTTAGAACATGAAGGTTATAAATATGAACGTATTGATGGTGGAATCACTGGGAACATGCGTCAGGAGGCCATTGATCGCT

TCAATG CACCGGGTGCTCAACAGTTCTGCTTCTTGCTTTCCACTCGAGCTGGGGGCCTTGGGATCAATCTGGCCACTGCGGACACAGTTATTATATATG

ACTCTGACTGGAACCCCCATAATGACATCCAG GCCTTTAGCAGAGCCCACCGTATTGGGCAAAATAAGAAGGTGATGATCTACCGGTTTGTGACCCGTG

CATCAGTGGAGGAGCGCATCACGCAGGTGGCAAAGAAGAAGATGATGCTGACACATTTAGTGGTACGGCCTGGCCTGGGCTCCAAGACAGGCTCAATGTC

TAAACAGGAGCTTGATGATATCCTCAAATTTGGCACTGAGGAGCTATTCAAGGATGAAGCCACGGATGGAG GAGGAGACAACAAGGAGGGAGAAGACAG

CAGTGTTATCCACTATGACGATAAGGCCATTGAACGACTGCTGGATCGAAACCAGGATGAGACTGAAGACACAGAATTGCAGGGCATGAATGAATATTTG

AGCTCATTCAAAGTGGCTCAGTATGTGGTACGGGAAGAAGAGATGGGG GAGGAAGAGGAGGTAGAACGGGAAATCATAAAACAGGAAGAAAGTGTGGAT

CCTGACTACTGGGAGAAATTGCTGCGGCACCATTATGAGCAGCAGCAAGAAGATCTAGCCCGAAATCTGGGCAAAGGAAAAAGAATCCGTAAACAGGTCA

ACTACAATGATGGCTCACAGGAGGACCGAG ATTGGCAGGACGACCAGTCCGACAACCAGTCCGATTACTCAGTGGCCTCAGAGGAAGGTGATGAAGACT

TTGACGAACGGTCAGAAG CTCCCCGCAGGCCCAGTCGCAAGGGCCTGCGGAATGATAAAGATAAGCCATTACCTCCTCTGTTGGCCCGTGTTGGTGGGA

ATATTGAA GTACTTGGTTTTAATGCTCGTCAGCGAAAAGCATTTCTTAATGCAATTATGCGATATGGCATGCCACCTCAGGATGCTTTTACCACTCAGT

GGCTTGTGAGAGATCTTCGAGGCAAGTCAGAGAAAGAATTTAA GGCTTATGTGTCACTCTTCATGCGACATTTGTGTGAGCCTGGGGCAGATGGGGCTG

AGACCTTTGCTGATGGCGTCCCACGAGAAGGCCTGTCTCGTCAACATGTTCTCACTAGGATCGGTGTCATGTCTCTGATTCGAAAGAAG GTTCAGGAGT

TTGAACATGTTAATGGACGCTGGAGCATGCCCGAACTGGCTGAAGTAGAGGAAAACAAAAAAATGTCTCAGCCAGGTTCACCTTCTCCAAAGACTCCTAC

ACCTTCCACACCAGGGGACACACAACCCAATACTCCTGCGCCTGTGCCACCTGCTG AGGATGGGATAAAAATAGAGGAAAATAGCCTTAAAGAAGAAGA

GAGCACAGAAGGAGAGAAGGAAGTTAAATCTACAGCCCCTGAGGCGACTGTGGAG TGTGCACAGCCCCCTGCCCCTGCCCCTGCCACTGCCCCTGCCAC

TGCCACTGCCCCTGAGGATGACAAGGCTCCTGCTGAGCCTCCTGAGGGGGAGGAAAAAGTGGAAAAGGCAGAGGTGAAGGAGAGAACAGAGGAGCCTATG

GAGACAGAGGCCAAAG GTACTACTGAGGTGGAGAAAGTGGAGGAGAAGTCTGCGGTAGACCTGACCCCGATCGTGGTGGAAGACAAAG AAGAGAAGAA

GGAGGAGGAGGAGAAAAAGGACGTGATGCTTCAGAATGGAGAAACTCCCAAGGATCTTAGTGATGAGAAGCAGAAGAAAAACAGCAAACAGCGTTTCATG

TTCAACATTGCAGATGGTGGTTTTACTG - UNI15285 - AGTTGCACTCACTGTGGCAGAATGAAGAGCGGGCAGCCACAGTCACTAAGAAGACTTA

CGAGATCTGGCACCGTCGCCATGATTACTGGCTGCTGGCTGGCATTATAAA CCACGGCTATGCCCGGTGGCAGGACATCCAGAATGACCCACGGTATGC

CATCCTCAATGAGCCTTTCAAGGGTGAAATGAATCGTGGCAATTTTCTAGAGATCAAGAATAAATTTTTAGCTCGAAGATTCAAG - UNI3289 - CT

CTTAGAACAAGCCCTGGTGATCGAGGAGCAGCTTCGCAGGGCAGCTTACCTGAACATGTCCGAGGACCCCTCTCACCCGTCTATGGCCCTTAACACCCGC

TTCGCTGAGGTGGAGTGTTTGGCAGAAAGTCACCAGCACCTGTCCAAGGAGTCGATGGCAGGGAATAAGCCGGCCAATGCAGTCCTACACAAAG - UNI

24448 - TCCTGAAACAGCTGGAGGAACTGTTGAGTGACATGAAAGCTGATGTGACGCGGCTCCCAGCCACCATTGCCCGCATCCCCCCAGTCGCTGTG

AGGTTACAGATGTCAGAGCGGAACATTCTCAGCCGCCTGGCAAACAGGGCGCCAGAACCTCCCCCACAGCAGGTAGCCCAGCAGCAGTGAAAGACCCAGA

GTGATATCCACCTCCACCACTCAGCAGTGACCTTCCTCACTTTCTCTTGTCCCGGCTGCCCCTGGGGGCCAGAGAGACCCTTGCCTTCCTTCTGCCCATC

TTCTGAGTTGTAAAGGAACAGCCCTGCGCAGTGGGGCAGGGAGGGAGGGAGAAGCAATGGTGCCCTTCCTGCTGGAGAGACAAGCAGCAGTAGCGCAGCG

CCCGCCCGCCATGTGCAGGAGCTGGCGGGCTGGCTGCCTTCTGGACCCTGGCTTCTCCCCACCGTGCGCCTGTTACAAACTGTTGTGGATTCTGCCAGGC

TCGAAGAAAATGATCTGAATTTCTTCCTCTTTTTGGTTTTATTTTGTTGGTTTACTTTGTGTTTTCTCCTTTTTGGGGGGTATTCAGAGTGGGCCGGGCC

CCTGGGCGAGACACAGCTACCTCTGTTGGCATCTTTTTAATACCAGGAACCCAGCGGCTCCAGCCACTGAGCAGCTAAATAAAGTTGG
Translation
 - UNI12070 - - UNI18800 - MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPE - UNI14806 - ENEEDPDEDLSEAETPKLKKKKKPK

KPRDPKIPKSKRQKKE - UNI25034 - LGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEEDEDDDSK - UN

I25034 - EPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVR RPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGASVAAAAAAAVA

VVESMVTATEVAPPPPPVEVPIRKAKTKEGKG - UNI8536 - GPNARRKPKGSPRVPDAKKPKPKKVAPLKIKLGGFGSKRKRSS SEDDDLDVESD

FDDASINSYSVSDGSTSRSSRSRKKLRTAKKKKKG - UNI9759 - GEEEVTAVDGYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPE

GKWSCPHC EKEGIQWEAKEDNSEGEEILEEVGGDPEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCT CPALKGKVQK

ILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSELQ LELHCQVMFRNYQRKNDMDEPPSGDFGGDEEKSRKRKNKDP

KFAEMEERFYRYGIKPEWMMIHRILNHS SVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDLFKQSYWNHR RELMRGEEGRPGKKLKKVKLRKLER

PPETPTVD PTVKYERQPEYLDATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKE GHSKGPFLVSAPLSTIINWEREFEMW

APDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMK KEASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSK FFRVLNGYSLQ

HKLLLTGTPLQNNLEELFHLLNFLTPERFH HNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSPMQK KKYYKYILT

RNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAM EAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQ MTKMLDLLEDFLEHE

GYKYERIDGGITGNMRQEAIDRFNA APGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQ AFSRAHRIGQNKKVMIYRFVTRASVEERITQ

VAKKKMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDEATDGG GGDNKEGEDSSVIHYDDKAIERLLDRNQDETEDTELQGMNEYLSSFKVAQ

YVVREEEMG EEEEVEREIIKQEESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRD DWQDDQSDNQSDYSVASEEGDEDFDERS

EA APRRPSRKGLRNDKDKPLPPLLARVGGNIE VLGFNARQRKAFLNAIMRYGMPPQDAFTTQWLVRDLRGKSEKEFK KAYVSLFMRHLCEPGADGAE

TFADGVPREGLSRQHVLTRIGVMSLIRKK VQEFEHVNGRWSMPELAEVEENKKMSQPGSPSPKTPTPSTPGDTQPNTPAPVPPAE EDGIKIEENSLKE

EESTEGEKEVKSTAPEATVE CAQPPAPAPATAPATATAPEDDKAPAEPPEGEEKVEKAEVKERTEEPMETEAKG GTTEVEKVEEKSAVDLTPIVVEDK

E EEKKEEEEKKDVMLQNGETPKDLSDEKQKKNSKQRFMFNIADGGFTE - UNI15285 - ELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAGIIN

 NHGYARWQDIQNDPRYAILNEPFKGEMNRGNFLEIKNKFLARRFK - UNI3289 - LLEQALVIEEQLRRAAYLNMSEDPSHPSMALNTRFAEVECL

AESHQHLSKESMAGNKPANAVLHKV - UNI24448 - VLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLANRAPEPPPQQVAQQQ

For any suggestions or comments, please send an email to unitrap@crg.es