Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000063887 (Nlgn1)
Chromosomal location
Chr 3: 25330763 - 26032656 (-)
Description
neuroligin 1 Gene [Source:MGI Symbol;Acc:MGI:2179435]
RefSeq_dna
NM_138666 
RefSeq_peptide
NP_619607.2 
UniGene
Mm.316080 
MGI
MGI:2179435 
Uniprot/SWISSPROT
Q99K10 
Uniprot/SPTREMBL
Q3TRZ1 Q3TY84 Q3UUP2 Q4KMN5 
Human Ortholog
not available
Omim not available
UniTrap UNI34694
Vector Insertion
Chr 3: 25338786 - 25594978
Public Clones IST12283C4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108308
Sequence
ATGGCACTTCCCAGATGCATGTGGCCAAATTATGTTTGGAGAGCTATGATGGCATGTGTGGTCCACAGGGGATCCGGTGCCCCATTGACTCTCTGCTTGT

TGGGATGTTTGCTACAGACTTTTCACGTACTCTCTCAAAAGTTGGATGATGTAGACCCATTGGTTACTACTAACTTTGGCAAGATTAGGGGAATTAAGAA

AGAACTCAATAATGAAATTTTGGGTCCTGTCATTCAGTTTCTTGGGGTTCCATATGCCGCTCCACCAACAGGAGAACATCGTTTCCAGCCTCCAGAACCA

CCATCTCCCTGGTCTGACATCCGGAACGCCACTCAGTTTGCTCCTGTATGTCCCCAGAATATCATTGATGGCAGATTGCCTGAAGTTATGCTTCCTGTGT

GGTTCACTAATAACTTGGATGTGGTTTCATCATACGTCCAAGACCAGAGTGAAGACTGTCTATACTTAAACATCTATGTCCCAACTGAAGATG ATATTC

GGGACAGTGGGGGTCCCAAACCAGTGATGGTGTACATCCATGGCGGCTCTTACATGGAAGGTACTGGAAATCTGTATGATGGGAGTGTCTTGGCAAGCTA

TGGCAATGTGATCGTCATCACAGTCAACTATCGGCTTGGGGTACTTGGTAAGATATCTC AGAAAGAGACCATCTCAGTTGCTTTTCAAGCCTTAAGAAC

CAAAGGTGGAGGCTTTATACCCAAACAAG - UNI34694 - CCACTTACAAAAGATGCGAGTAA
Translation
MALPRCMWPNYVWRAMMACVVHRGSGAPLTLCLLGCLLQTFHVLSQKLDDVDPLVTTNFGKIRGIKKELNNEILGPVIQFLGVPYAAPPTGEHRFQPPEP

PSPWSDIRNATQFAPVCPQNIIDGRLPEVMLPVWFTNNLDVVSSYVQDQSEDCLYLNIYVPTEDD DIRDSGGPKPVMVYIHGGSYMEGTGNLYDGSVLA

SYGNVIVITVNYRLGVLGKISQ QKETISVAFQALRTKGGGFIPKQA - UNI34694 - ATYKRCE
Transcript ENSMUST00000075054
Sequence
ATGGCACTTCCCAGATGCATGTGGCCAAATTATGTTTGGAGAGCTATGATGGCATGTGTGGTCCACAGGGGATCCGGTGCCCCATTGACTCTCTGCTTGT

TGGGATGTTTGCTACAGACTTTTCACGTACTCTCTCAAAAGTTGGATGATGTAGACCCATTGGTTACTACTAACTTTGGCAAGATTAGGGGAATTAAGAA

AGAACTCAATAATGAAATTTTGGGTCCTGTCATTCAGTTTCTTGGGGTTCCATATGCCGCTCCACCAACAGGAGAACATCGTTTCCAGCCTCCAGAACCA

CCATCTCCCTGGTCTGACATCCGGAACGCCACTCAGTTTGCTCCTGTATGTCCCCAGAATATCATTGATGGCAGATTGCCTGAAGTTATGCTTCCTGTGT

GGTTCACTAATAACTTGGATGTGGTTTCATCATACGTCCAAGACCAGAGTGAAGACTGTCTATACTTAAACATCTATGTCCCAACTGAAGATG GTCCCC

TTACAAAGAAACACACAGATGATTTAGGTGATAATGACGGTGCTGAAGATGAAG ATATTCGGGACAGTGGGGGTCCCAAACCAGTGATGGTGTACATCC

ATGGCGGCTCTTACATGGAAGGTACTGGAAATCTGTATGATGGGAGTGTCTTGGCAAGCTATGGCAATGTGATCGTCATCACAGTCAACTATCGGCTTGG

GGTACTTG - UNI34694 - GCTTCTTGAGCACAGGGGATCAGGCTGCCAAAGGAAACTACGGGCTCCTTGACCTCATCCAGGCCCTAAGATGGACCA

GCGAGAACATTGGGTTCTTTGGTGGTGACCCCTTGCGAATCACTGTGTTTGGATCAGGCGCTGGGGGTTCATGTGTCAACCTGCTGACTTTATCCCATTA

TTCTGAAGGTAACCGTTGGAGCAATTCAACCAAAG - UNI34694 - GACTTTTTCAACGAGCAATAGCTCAGAGTGGAACAGCCCTTTCCAGCTGGG

CTGTTAGTTTCCAGCCTGCAAAATACGCTAGAATTCTGGCCACAAAAGTTGGCTGCAATGTTTCAGATACAGTAGAGTTAGTAGAATGCCTGCAGAAGAA

GCCTTACAAAGAACTTGTTGATCAAGATGTTCAACCAGCCCGATACCACATAGCCTTTGGACCTGTGATCGATGGTGATGTAATACCAGATGACCCTCAG

ATACTGATGGAACAAGGAGAGTTCCTCAACTATGATATAATGTTGGGAGTTAACCAAGGGGAAGGGTTGAAGTTTGTCGAAAATATAGTAGATAGTGATG

ATGGTGTATCAGCCAGTGATTTCGACTTTGCTGTTTCTAATTTTGTTGATAATTTATATGGATATCCTGAAGGCAAAGATGTTTTGAGAGAAACCATTAA

ATTCATGTATACTGACTGGGCTGATCGCCATAATCCTGAAACTAGAAGGAAGACATTGTTGGCTTTGTTTACGGACCATCAATGGGTAGCACCTGCTGTG

GCCACAGCAGACCTTCACTCGAACTTTGGCTCACCTACATACTTCTATGCCTTTTATCATCATTGCCAAACAGATCAAGTTCCAGCTTGGGCTGATGCAG

CTCATGGGGATGAGGTTCCCTATGTGTTGGGAATCCCCATGATTGGCCCTACAGAGTTATTTCCTTGCAATTTCTCCAAGAATGATGTGATGTTGAGTGC

AGTAGTAATGACATACTGGACGAATTTTGCTAAAACTGG TGACCCAAATCAACCAGTTCCTCAAGACACAAAATTCATCCATACCAAACCCAACCGCTT

TGAAGAAGTAGCATGGACCAGATATTCCCAGAAAGACCAGCTTTATCTCCATATTGGATTAAAACCGAGAGTTAAAGAGCATTACAGAGCCAATAAGGTA

AATCTCTGGCTGGAGCTGGTACCTCATCTGCATAATCTCAATGACATTTCTCAGTATACCTCGACAACAACTAAAGTGCCATCCACGGACATCACTCTCA

GACCTACAAGGAAGAATTCCACACCAGTCACATCAGCCTTTCCCACTGCCAAACAGGATGATCCCAAGCAACAACCAAGCCCCTTCTCGGTGGATCAGAG

GGACTACTCCACAGAGCTAAGTGTCACTATCGCAGTGGGGGCCTCTCTGCTGTTTCTCAACATCTTGGCTTTTGCAGCCCTGTACTACAAGAAGGATAAG

AGGAGACATGATGTCCACCGGAGGTGCAGCCCTCAGCGCACGACCACCAACGACCTAACCCATGCTCCAGAAGAGGAAATTATGTCTCTCCAAATGAAGC

ACACTGACTTGGATCACGAGTGTGAGTCCATCCATCCACATGAGGTGGTTCTTCGGACCGCCTGTCCCCCAGATTATACTCTAGCTATGAGGAGGTCACC

TGATGATATTCCACTAATGACACCTAACACCATCACAATGATTCCCAACACTATACCAGGGATTCAGCCCTTACATACATTCAACACATTTACTGGAGGA

CAGAATAATACACTGCCCCATCCCCACCCACACCCCCATTCACATTCAACAACCAGGGTATAGCCAGATGAGAGAGACAAACTGATTTTTTTTTCTGATG

GAGTGCAGTAAAAGATTATTGGAAGATTCCTTGGCTTTCAACTCGGAAGACTCTCACTATTTAAATAAGGAGGAATATTATGTGAATATACATATCAAGA

ACTTTGGGGGTTTTGAAAAATGAATTGTATATAGATATACACACAAATCAACTTTAAAAAAAAAAGCAAATTCCAATTGCGTGAAGCAATTGTTCTGAAT

GATACTTTTTCATTCACTTTCAAGAATTAATTTGTTGAAGATTTAAGTTACTTAACGGAGTTAGGCATGTGGAACACCAAACAGGAAAGTACTGTGTCTG

AATACTTTAAAAACAAACAAAAAACAAAAACAAAAACAAAAATAAAATCAACTATGAATATGCACAAGGGACACACCAATGGAATGTCAGATAATTTCGC

CAGTTTTCATTTGGAGCCCTTTAATTGTGTAGACCATATTTGCTTAAGTACACAGGACACCTATGCTGTTAATGGCATAGCAGAAGTTCATGCTGAAAAT

TGCCAGTAAAACAAAGAAGTTGCCATAAGACTGGCAGGTACAACATTATCACATAAGTGCTGTCAGTACTAAGTCGTGGGGATCAAGGAGACTGGATATT

TTTAGCACGATGTGCATGATAATTTATATGCTTGGTGGCTGTGCTGCTGGTTAAGCCGTAATTAAAATTCTTCTCATCCCATTGGAGTTTTTAATAGGAG

CTTCCTCCATCAATTGGCAGAAACTAAAGAAGATATTATAAGGGGCAAAAGTAATTACTATAAAATAATTTGCAGTAGTTTTGATAATAGAGGGAATAGT

TATTAAAGTCTTGGGAGAAACTAGAGGTATAGTGGTGAATACTCACTGATATGAATCCCAGAAAAAAAATTCTATAAGTTTAATATTCTTTTCATTCCCT

TATATGTAATTTATAGAAATACAACTCTAATTGAACATGTGTTAGCTGCAGAGCTATAATTTGCTGTGGGTTTGTTACTCTGAAGTTTGCTCCTTTCGTT

AACAGTCTTGCAAGGTGTAAGGATGCCCCAACAGTACCATTCTGATTACAGTTCTCAGTCGATTGATTTACTCATGTTGCATGACAAAATGTTTACTACT

AAGAATTCAATAGAAAGCATAGTCCCTCTTCACATTGCATCTTTCTCGCTGAGGGTCTCTTGAATTTACTCATGAGATCTCAGTAGAGGAACAATGTAGG

TGCAGAACCTAGGAGAGTCAACAGCTGGAGGGTTTGTCTTTCACATATGTGCAATTTCAAATGAATTCTCGAAGACCACAGGAATCTCTGAATCCCCTGT

TGTTTACCAGTAATATCAGTATATCACAGACCTTTCCAAATGTTTGTATATGTAATCAGATGTACATTTATATTAAAAAAAAAAACAATGAGATGGACCT

CAAGAGCACATGCTGATCAATGGTTTCTCTCTTATCTGTACTATATTTCTATTAGACTAAAGTTATGTGATTTTTTTTTACCTTTTTTCAGATGACTAGC

AATTTTGATAGTTTGTAAGATAATGCAAAGGACTTTCTCTGACTAACTGCTGTAACAGAAACCTTTCTTTCCAGCTACCCTTTTTCAAGAATCGAAAGCT

TATTATACAAAAGCAAACACTTGTATACTACTCGGTGGGAAGGATGCTGTGTATCACGACCACATCCGTGGTCCTTGGGTGAAATAAAGATAATATGGAG

AATGGCGATTAGTCAAATGCTAAGAGACATGATCTTTGCTCATTAAAGAGCTAAAACGTT
Translation
MALPRCMWPNYVWRAMMACVVHRGSGAPLTLCLLGCLLQTFHVLSQKLDDVDPLVTTNFGKIRGIKKELNNEILGPVIQFLGVPYAAPPTGEHRFQPPEP

PSPWSDIRNATQFAPVCPQNIIDGRLPEVMLPVWFTNNLDVVSSYVQDQSEDCLYLNIYVPTEDG GPLTKKHTDDLGDNDGAEDED DIRDSGGPKPVM

VYIHGGSYMEGTGNLYDGSVLASYGNVIVITVNYRLGVLG - UNI34694 - GFLSTGDQAAKGNYGLLDLIQALRWTSENIGFFGGDPLRITVFGSG

AGGSCVNLLTLSHYSEGNRWSNSTKG - UNI34694 - GLFQRAIAQSGTALSSWAVSFQPAKYARILATKVGCNVSDTVELVECLQKKPYKELVDQD

VQPARYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGVNQGEGLKFVENIVDSDDGVSASDFDFAVSNFVDNLYGYPEGKDVLRETIKFMYTDWADR

HNPETRRKTLLALFTDHQWVAPAVATADLHSNFGSPTYFYAFYHHCQTDQVPAWADAAHGDEVPYVLGIPMIGPTELFPCNFSKNDVMLSAVVMTYWTNF

AKTG GDPNQPVPQDTKFIHTKPNRFEEVAWTRYSQKDQLYLHIGLKPRVKEHYRANKVNLWLELVPHLHNLNDISQYTSTTTKVPSTDITLRPTRKNST

PVTSAFPTAKQDDPKQQPSPFSVDQRDYSTELSVTIAVGASLLFLNILAFAALYYKKDKRRHDVHRRCSPQRTTTNDLTHAPEEEIMSLQMKHTDLDHEC

ESIHPHEVVLRTACPPDYTLAMRRSPDDIPLMTPNTITMIPNTIPGIQPLHTFNTFTGGQNNTLPHPHPHPHSHSTTRV

For any suggestions or comments, please send an email to unitrap@crg.es