Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000063972 (Nr6a1)
Chromosomal location
Chr 2: 38578890 - 38783208 (-)
Description
nuclear receptor subfamily 6, group A, member 1 Gene [Source:MGI (curated);Acc:Nr6a1-001]
RefSeq_dna
NM_010264 
RefSeq_peptide
NP_034394.1 
UniGene
Mm.397159 Mm.407428 Mm.439703 
MGI
MGI:1352459 
Uniprot/SWISSPROT
Q64249 
Human Ortholog
ENSG00000148200 (NR6A1)
Omim not available
UniTrap UNI35996
Vector Insertion
Chr 2: 38781637 - 38783209
Public Clones IST11830D3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15829
Vector Insertion
Chr 2: 38740758 - 38781637
Public Clones (ggtc) IST14629A3 (tigm) IST14353H2 (tigm) IST11375A9 (tigm) IST14122A8 (tigm)
IST12573H9 (tigm) IST12524B11 (tigm) IST14632E12 (tigm) IST12484E7 (tigm)
IST12275B6 (tigm) IST10068D10 (tigm)
Private Clones OST472179 (lexicon) OST448876 (lexicon) OST415003 (lexicon) OST290153 (lexicon)
OST276945 (lexicon) OST157476 (lexicon) OST135578 (lexicon) OST133611 (lexicon)
OST123478 (lexicon) OST78676 (lexicon) OST68374 (lexicon) OST45215 (lexicon)
OST43809 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5314
Vector Insertion
Chr 2: 38728160 - 38740715
Public Clones RRA042 (baygenomics) SYA301 (baygenomics) 5SE306B10 (ggtc) IST14885B10 (tigm)
IST14753E6 (tigm) IST13062E6 (tigm)
Private Clones OST438256 (lexicon) OST432371 (lexicon) OST413186 (lexicon) OST401576 (lexicon)
OST357655 (lexicon) OST345339 (lexicon) OST341572 (lexicon)
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5735
Vector Insertion
Chr 2: 38617799 - 38728114
Public Clones CSI189 (baygenomics) (ggtc) IST12223A11HMR1 (tigm) IST14382H11 (tigm)
IST13320C6 (tigm) IST14835C2 (tigm) IST15049G6 (tigm) IST12298C3 (tigm)
IST13860G10 (tigm) IST12233E11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13761
Vector Insertion
Chr 2: 38615956 - 38617788
Public Clones CMHD-GT_465D8-3 (cmhd) CMHD-GT_268D4-3 (cmhd)
Private Clones OST448590 (lexicon) OST365201 (lexicon) OST320408 (lexicon) OST147283 (lexicon)
OST57753 (lexicon)
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6449
Vector Insertion
Chr 2: 38604412 - 38615706
Public Clones CSA119 (baygenomics) CMHD-GT_268E4-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112875
Sequence
CAGAGGAGGGAGCTGGCCAGTGCTGAGGGGGCGCGGCGCGGAGGGGCGCGGAGCCGGGCGGCTCAGGGGCCCAGAGAGTGCGGCGGCCGAGAGCCTGCCG

GCCCCTGACAGCCCCCTCCCCCCGTGGAAGACCAGGACGACGACTACGAAGGCGCAAGTCATGGCGGAGCAGCGAAGCCCGAGAGGGCCCTGAGCACCGC

CGCATGGAGCGGGACGAACGGCCACCTAGCGGAGGGGGAGGCGGCGGGGGCTCGGCGGGGTTCCTGGAGCCGCCCGCCGCGCTCCCTCCGCCGCCGCGCA

ACG - UNI15829 - - UNI35996 - GTTTCTGTCAGGATGAATTGGCAGAGCTTGATCCAGGCACTA - UNI5314 - - UNI5735 - - U

NI13761 - TTTCCGTCCCAGATGATCGAGCTGAACAACGAACCTGTCTCATCTGTGGGGACCGCGCTACGGGCTTGCACTATGGGATCATCTCCTGCG

AGGGCTGCAAGGGGTTTTTCAAGAGGAGCATTTGCAACAAACGGGTGTATCGGTGCAGTCGTGACAAGAACTGTGTCATGTCCCGGAAGCAGAGGAACAG

ATGTCAGTACTGCCGCCTGCTCAAGTGTCTCCAGATGGGCATGAACAGGAAGG - UNI6449 - CTATCAGAGAAGATGGCATGCCTGGAGGCCGGAA

CAAGAGCATTGGACCAGTCCAG ATATCAGAAGAAGAAATTGAAAGAATCATGTCTGGACAGGAGTTTGAGGAAGAAGCCAATCACTGGAGCAACCATGG

TGACAGCGACCACAGTTCCCCTGGGAACAGGGCTTCAGAGAGCAACCAGCCCTCACCAGGCTCCACACTATCATCCAG TAGGTCTGTGGAACTAAATGG

ATTCATGGCATTCAGGGATCAGTACATGGGGATGTCAGTGCCTCCACATTATCAATACATACCACACCTTTTTAGCTATTCTGGCCACTCACCACTTTTG

CCCCCACAAGCTCGAAGCCTGGACCCTCAGTCCTACAGTCTGATTCATCAGCTGATGTCAGCCGAAGACCTGGAGCCATTGGGCACACCTATGTTGATTG

AAGATGG GTATGCTGTGACACAGGCAGAACTGTTTGCTCTGCTTTGCCGCCTGGCCGACGAGTTGCTCTTTAGGCAGATTGCCTGGATCAAGAAGCTGC

CTTTCTTCTGCGAGCTCTCAATCAAGGATTACACGTGCCTCTTGAGCTCTACGTGGCAGGAGTTAATCCTGCTCTCCTCCCTCACAGTGTACAGCAAGCA

GATCTTTGGGGAGCTGGCTGATGTCACAGCCAAGTACTCACCCTCTGATGAAGAACTCCACAG ATTTAGTGATGAAGGGATGGAGGTGATTGAACGACT

CATCTACCTATATCACAAGTTCCATCAGCTGAAGGTCAGCAACGAGGAGTACGCATGCATGAAAGCAATTAACTTCCTGAATCAAG ATATCAGGGGTCT

GACCAGTGCCTCACAGCTGGAACAACTGAACAAGCGGTATTGGTACATTTGTCAGGATTTCACTGAATATAAATACACACATCAGCCAAACCGCTTTCCT

GATCTTATGATGTGCTTGCCAGAGATCCGATACATCGCAG GCAAGATGGTGAATGTGCCCCTGGAGCAGCTGCCCCTCCTCTTTAAGGTGGTGCTGCAC

TCCTGCAAGACAAGTACGGTGAAGGAGTGACCTGTGCCCTGCACCTCCTTGGGCCACCCACAGTGCCTTGGGTAGGCAGCACAGGCTCCAGAGGAAAGAG

CCAGAGACCAAGATGGAGACTGTGGAGCAGCTACCTCCATCACAAGAAGAATTTGTTTGTTTGTCTGTTTTTAACCTCATTTTTCTATATATTTATTTCA

CGACAGAGTTGAATGTATGGCCTTCAACATGATGCACATGCTTTTGTGTGAATGCAGCAGATGCATTTCCTTGCAGTTTACAGAATGTGAAGATGTTTAA

TGTTACCGTGTTGTCATTGTTTAGAGATAGGTTTTTTTGTATTTTGAGGGAGAGGGTAGGATGGACTAGATGAGTATTTCCATAATGTTGACAAAGACAA

CTACCTCAATGGAAACAGGTGTATGACCATCCCTACCTTTTCCACATTTTCTCAGCAGATACACACTTGTCTGTTAGAGAGCAAACTGCCTTTTTTATAG

CCACAGACTTCTAAGTAAAAGAAGCAAACAAAGGAGCGAAGTGGTATAGGGAGATTTACTAATGGCCAGTGGGACATCTGAGAGGCAATTTGATTTTGAT

CATCTCATCCCACAAGCCTGAAGGGCAGAAACTCTGCCTTACCTTCTGCTGCACCCCTCCCCCACACGCTGTTGTCTGTTGATGCTGCTGTCAAGTTTTC

ATCCAGGTAGAGTCCTAACAATAAGCCAGTATGTAGGACTTGCCTCCCAGCGCCCTTGTAGCTCATAGCTGCCTAGTTTGCTGTTCTAGATCTACCAAGG

CCTACCTTCTTCAGACCCCATCCCTACCTCTTATGAATTTGACTTCCTGTCAGTCCTTTAGAAAGGGACAGGAAAATGCCATGTTCTGAATTCTGATGCC

ATTTCTGATTTGTTTTTTACATTGTTTCCCTCAAAAGGTAGAG
Translation
MERDERPPSGGGGGGGSAGFLEPPAALPPPPRNG - UNI15829 - - UNI35996 - GFCQDELAELDPGTI - UNI5314 - - UNI5735 -

 - UNI13761 - ISVPDDRAEQRTCLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNCVMSRKQRNRCQYCRLLKCLQMGMNRKA - U

NI6449 - AIREDGMPGGRNKSIGPVQ ISEEEIERIMSGQEFEEEANHWSNHGDSDHSSPGNRASESNQPSPGSTLSSS SRSVELNGFMAFRDQYMG

MSVP    
Transcript ENSMUST00000112876
Sequence
ATGGAGACAT - UNI13761 - GTTTAGTTTCCGTCCCAGATGATCGAGCTGAACAACGAACCTGTCTCATCTGTGGGGACCGCGCTACGGGCTTGCA

CTATGGGATCATCTCCTGCGAGGGCTGCAAGGGGTTTTTCAAGAGGAGCATTTGCAACAAACGGGTGTATCGGTGCAGTCGTGACAAGAACTGTGTCATG

TCCCGGAAGCAGAGGAACAGATGTCAGTACTGCCGCCTGCTCAAGTGTCTCCAGATGGGCATGAACAGGAAGG - UNI6449 - CTATCAGAGAAGAT

GGCATGCCTGGAGGCCGGAACAAGAGCATTGGACCAGTCCAG ATATCAGAAGAAGAAATTGAAAGAATCATGTCTGGACAGGAGTTTGAGGAAGAAGCC

AATCACTGGAGCAACCATGGTGACAGCGACCACAGTTCCCCTGGGAACAGGGCTTCAGAGAGCAACCAGCCCTCACCAGGCTCCACACTATCATCCAG T

AGGTCTGTGGAACTAAATGGATTCATGGCATTCAGGGATCAGTACATGGGGATGTCAGTGCCTCCACATTATCAATACATACCACACCTTTTTAGCTATT

CTGGCCACTCACCACTTTTGCCCCCACAAGCTCGAAGCCTGGACCCTCAGTCCTACAGTCTGATTCATCAGCTGATGTCAGCCGAAGACCTGGAGCCATT

GGGCACACCTATGTTGATTGAAGATGG GTATGCTGTGACACAGGCAGAACTGTTTGCTCTGCTTTGCCGCCTGGCCGACGAGTTGCTCTTTAGGCAGAT

TGCCTGGATCAAGAAGCTGCCTTTCTTCTGCGAGCTCTCAATCAAGGATTACACGTGCCTCTTGAGCTCTACGTGGCAGGAGTTAATCCTGCTCTCCTCC

CTCACAGTGTACAGCAAGCAGATCTTTGGGGAGCTGGCTGATGTCACAGCCAAGTACTCACCCTCTGATGAAGAACTCCACAG ATTTAGTGATGAAGGG

ATGGAGGTGATTGAACGACTCATCTACCTATATCACAAGTTCCATCAGCTGAAGGTCAGCAACGAGGAGTACGCATGCATGAAAGCAATTAACTTCCTGA

ATCAAG ATATCAGGGGTCTGACCAGTGCCTCACAGCTGGAACAACTGAACAAGCGGTATTGGTACATTTGTCAGGATTTCACTGAATATAAATACACAC

ATCAGCCAAACCGCTTTCCTGATCTTATGATGTGCTTGCCAGAGATCCGATACATCGCAG GCAAGATGGTGAATGTGCCCCTGGAGCAGCTGCCCCTCC

TCTTTAAGGTGGTGCTGCACTCCTGCAAGACAAGTACGGTGAAGGAGTGACCTGTGCCCTGCACCTCCTTGGGCCACCCACAGTGCCTTGGGTAGGCAGC

ACAGGCTCCAGAGGAAAGAGCCAGAGACCAAGATGGAGACTGTGGAGCAGCTACCTCCATCACAAGAAGAATTTGTTTGTTTGTCTGTTTTTAACCTCAT

TTTTCTATATATTTATTTCACGACAGAGTTGAATGTATGGCCTTCAACATGATGCACATGCTTTTGTGTGAATGCAGCAGATGCATTTCCTTGCAGTTTA

CAGAATGTGAAGATGTTTAATGTTACCGTGTTGTCATTGTTTAGAGATAGGTTTTTTTGTATTTTGAGGGAGAGGGTAGGATGGACTAGATGAGTATTTC

CATAATGTTGACAAAGACAACTACCTCAATGGAAACAGGTGTATGACCATCCCTACCTTTTCCACATTTTCTCAGCAGATACACACTTGTCTGTTAGAGA

GCAAACTGCCTTTTTTATAGCCACAGACTTCTAAGTAAAAGAAGCAAACAAAGGAGCGAAGTGGTATAGGGAGATTTACTAATGGCCAGTGGGACATCTG

AGAGGCAATTTGATTTTGATCATCTCATCCCACAAGCCTGAAGGGCAGAAACTCTGCCTTACCTTCTGCTGCACCCCTCCCCCACACGCTGTTGTCTGTT

GATGCTGCTGTCAAGTTTTCATCCAGGTAGAGTCCTAACAATAAGCCAGTATGTAGGACTTGCCTCCCAGCGCCCTTGTAGCTCATAGCTGCCTAGTTTG

CTGTTCTAGATCTACCAAGGCCTACCTTCTTCAGACCCCATCCCTACCTCTTATGAATTTGACTTCCTGTCAGTCCTTTAGAAAGGGACAGGAAAATGCC

ATGTTCTGAATTCTGATGCCATTTCTGATTTGTTTTTTACATTGTTTCCCTCAAAAGGTAGAG
Translation
METC - UNI13761 - CLVSVPDDRAEQRTCLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNCVMSRKQRNRCQYCRLLKCLQMGMNR

KA - UNI6449 - AIREDGMPGGRNKSIGPVQ ISEEEIERIMSGQEFEEEANHWSNHGDSDHSSPGNRASESNQPSPGSTLSSS SRSVELNGFMAF

RDQYMGMSVPPHYQYIPHLFSYSGHSPLLPPQARSLDPQSYSLIHQLMSAEDLEPLGTPMLIEDG GYA   
Transcript ENSMUST00000112877
Sequence
ATTCCAGGGGCACATGGGGCAGAATGAAGTGACAGAATGAAACCGCTTCGATACGGCCCATTAGAGGAAAGCCCAGCAAAGCACCAGAGTTCTTTGATTT

ATA - UNI35996 - AGTCCCGTGTGGGCAGCCTCGTTGGGAGGACTACATTTCCCAGAATTCCTCACGGGCATGTGCGTGGCAGCGGCGCGTGACGT

CAGAGGAGGGAGCTGGCCAGTGCTGAGGGGGCGCGGCGCGGAGGGGCGCGGAGCCGGGCGGCTCAGGGGCCCAGAGAGTGCGGCGGCCGAGAGCCTGCCG

GCCCCTGACAGCCCCCTCCCCCCGTGGAAGACCAGGACGACGACTACGAAGGCGCAAGTCATGGCGGAGCAGCGAAGCCCGAGAGGGCCCTGAGCACCGC

CGCATGGAGCGGGACGAACGGCCACCTAGCGGAGGGGGAGGCGGCGGGGGCTCGGCGGGGTTCCTGGAGCCGCCCGCCGCGCTCCCTCCGCCGCCGCGCA

ACG - UNI15829 - - UNI35996 - GTTTCTGTCAGGATGAATTGGCAGAGCTTGATCCAGGCACTA - UNI5314 - ATGGAGAGACTGACA

GTTTAACACTTGGCCAAGGCCATATACCTG - UNI5735 - - UNI13761 - TTTCCGTCCCAGATGATCGAGCTGAACAACGAACCTGTCTCATC

TGTGGGGACCGCGCTACGGGCTTGCACTATGGGATCATCTCCTGCGAGGGCTGCAAGGGGTTTTTCAAGAGGAGCATTTGCAACAAACGGGTGTATCGGT

GCAGTCGTGACAAGAACTGTGTCATGTCCCGGAAGCAGAGGAACAGATGTCAGTACTGCCGCCTGCTCAAGTGTCTCCAGATGGGCATGAACAGGAAGG 

- UNI6449 - CTATCAGAGAAGATGGCATGCCTGGAGGCCGGAACAAGAGCATTGGACCAGTCCAG ATATCAGAAGAAGAAATTGAAAGAATCATGT

CTGGACAGGAGTTTGAGGAAGAAGCCAATCACTGGAGCAACCATGGTGACAGCGACCACAGTTCCCCTGGGAACAGGGCTTCAGAGAGCAACCAGCCCTC

ACCAGGCTCCACACTATCATCCAG TAGGTCTGTGGAACTAAATGGATTCATGGCATTCAGGGATCAGTACATGGGGATGTCAGTGCCTCCACATTATCA

ATACATACCACACCTTTTTAGCTATTCTGGCCACTCACCACTTTTGCCCCCACAAGCTCGAAGCCTGGACCCTCAGTCCTACAGTCTGATTCATCAGCTG

ATGTCAGCCGAAGACCTGGAGCCATTGGGCACACCTATGTTGATTGAAGATGG GTATGCTGTGACACAGGCAGAACTGTTTGCTCTGCTTTGCCGCCTG

GCCGACGAGTTGCTCTTTAGGCAGATTGCCTGGATCAAGAAGCTGCCTTTCTTCTGCGAGCTCTCAATCAAGGATTACACGTGCCTCTTGAGCTCTACGT

GGCAGGAGTTAATCCTGCTCTCCTCCCTCACAGTGTACAGCAAGCAGATCTTTGGGGAGCTGGCTGATGTCACAGCCAAGTACTCACCCTCTGATGAAGA

ACTCCACAG ATTTAGTGATGAAGGGATGGAGGTGATTGAACGACTCATCTACCTATATCACAAGTTCCATCAGCTGAAGGTCAGCAACGAGGAGTACGC

ATGCATGAAAGCAATTAACTTCCTGAATCAAG ATATCAGGGGTCTGACCAGTGCCTCACAGCTGGAACAACTGAACAAGCGGTATTGGTACATTTGTCA

GGATTTCACTGAATATAAATACACACATCAGCCAAACCGCTTTCCTGATCTTATGATGTGCTTGCCAGAGATCCGATACATCGCAG GCAAGATGGTGAA

TGTGCCCCTGGAGCAGCTGCCCCTCCTCTTTAAGGTGGTGCTGCACTCCTGCAAGACAAGTACGGTGAAGGAGTGACCTGTGCCCTGCACCTCCTTGGGC

CACCCACAGTGCCTTGGGTAGGCAGCACAGGCTCCAGAGGAAAGAGCCAGAGACCAAGATGGAGACTGTGGAGCAGCTACCTCCATCACAAGAAGAATTT

GTTTGTTTGTCTGTTTTTAACCTCATTTTTCTATATATTTATTTCACGACAGAGTTGAATGTATGGCCTTCAACATGATGCACATGCTTTTGTGTGAATG

CAGCAGATGCATTTCCTTGCAGTTTACAGAATGTGAAGATGTTTAATGTTACCGTGTTGTCATTGTTTAGAGATAGGTTTTTTTGTATTTTGAGGGAGAG

GGTAGGATGGACTAGATGAGTATTTCCATAATGTTGACAAAGACAACTACCTCAATGGAAACAGGTGTATGACCATCCCTACCTTTTCCACATTTTCTCA

GCAGATACACACTTGTCTGTTAGAGAGCAAACTGCCTTTTTTATAGCCACAGACTTCTAAGTAAAAGAAGCAAACAAAGGAGCGAAGTGGTATAGGGAGA

TTTACTAATGGCCAGTGGGACATCTGAGAGGCAATTTGATTTTGATCATCTCATCCCACAAGCCTGAAGGGCAGAAACTCTGCCTTACCTTCTGCTGCAC

CCCTCCCCCACACGCTGTTGTCTGTTGATGCTGCTGTCAAGTTTTCATCCAGGTAGAGTCCTAACAATAAGCCAGTATGTAGGACTTGCCTCCCAGCGCC

CTTGTAGCTCATAGCTGCCTAGTTTGCTGTTCTAGATCTACCAAGGCCTACCTTCTTCAGACCCCATCCCTACCTCTTATGAATTTGACTTCCTGTCAGT

CCTTTAGAAAGGGACAGGAAAATGCCATGTTCTGAATTCTGATGCCATTTCTGATTTGTTTTTTACATTGTTTCCCTCAAAAGGTAGAGGGGCAAAGACC

AGGCTGCTGAAAGAATAAAGACTTCTTTGGAAGTCGCTGTTCTCACCCAACCTTATCCTCTGAACCAAATCCAAAATCCAAAACTGCCACTTTTAAACAG

TAGAAAGGACCAGAAACTTTGCTGCAAATTTTTGTTGTAAGTTCTCCCATTAGTCCCAAAATGAGATTTGTTTGCCAGGGTCTAGAACAGAAAGTCAAGA

CCCAGAGAAGCCCAGCTCTTCCTTCAAGTATTATCAGGGATCTAACCTACCAAGGTTTGGAGGGATGGAGCCAGAAAGACCTAGAAAGGAAAGGGGCATT

AAACTACCTCATGTTTCTAAGGGCTAGGCTGCTGCTCTGCAGCTGCAGCCTGGGCCCCTGTGCTTTACTGCCTACCCCATCTAGTTCTAGGAAGAGTTTT

TACCCTCCAGACTTTGGCCAGACCAACTAGGTTTGTCTTAGAGCTGTTTCAGCTGCTTTTCCCTTTCTTTGTACCAGGCTCTCCTACCACTAGTACCCCA

GACACATGCTCCACTGGCTGGTATCTCGTGCTGGGTCTGCCTCACCCACAGTATCTTTTTTAGCCTGTTTTGTCAGGAACTGTTTACACTTCCCCAGTGA

AGCCTATTAACTTACCCTGGAGACAACAGCATCCTGTGCCTCCTAGGTAGTGCCTCCATTTGTCAGTTTTTCTCTTTAGTGAAATGATACAGGTACCAGC

AAAGTGACAATATGTCCTTTGATGTCCAAAGTTCAGAACATTATTTCTTCTCATTCTTATTCCCCAGCCACTTGAGAGAGAAAAAGTTCCAGATAGAATG

TTTTTCACGTTTGTGGGAAGATATATGTATTGATGTGTCTGTTTCTGAGCTCACAATATTTTCATGTTTGCCTGAATTTTTATATTTAACCAACCAGATC

ATGTTATTTGGCTCTGGGTCAGATTCTCAGCTGCTTTCCTCAAGCTAGAAATCAGAGACACAGTTCAGAGACAGCACCTCTGTGCACACAGCAGCCTTCT

TTGCTTAGACTTCCATTTATCAAATTGGTACTTTTTTAAATTGCTTTTCAAATTAGCATTTTACCTGTTGTGTTGAATGTCAAAGCTCTGATGAGACAAG

AACATATCTTTCCAATAATGTAGTATTAAACAGAGCAAGTTGTTAATTTGTAGAGTGGGGGAAAGGTTCTGCAAGTTGCCATTGTACAAATCCATTTTTA

CAAATGTTTGCAGCAGATTCCACAGAACAAAGAGCCCATTCATTGCCAAGAGCCCTGCAGAATCTCTGAGCCAAGTGGCTGTGTGTTCCGAGCTGGAGCC

TGACCTGTGGACCGCCTTTAATGTCTTCTGCACCCAGTCCTTTTATGACATGGGCTTCTTTTAAACAGGGTAAAGTAAATGGGCTGCTTTGCAAACTCAG

GTATTATGAGGAGAAGGTAGGAGTGTAGCTAGCAGCGTGGAGACATTAGGTCAGCCACTAGATGTATTTGTGATTTTGGTTTGAAGGACACAGAGAAAGG

TTGGAGGAGGAGGTTTGGTATGCTTGTTTTTTGCCTTTTTTCCTATAATGTTTGATTAACAGGCAGCCTTTTAGCTAGTGGAAGAAGGAAAAACTTGTGC

ATGCTATATCTCATTCCCCCCTCTCTCTCTCCTGTCCTCTCTGATCCAGACCACCAAAAATACTCACTTTGAGTGAGAATTTTTCAACCATAAAAACATA

TAGCCCCCAAAGCCATGTGGAGAAGGAGAGCCCACCTCCTTGCACTGTGCTGAAACATAGAGGTTTCCCCCTGCCTTTTCTTATGTATGCTTTCTTGACC

CAAGGCAGAAGTGTGGAGTCTTAGAGCTTTGTAATTCCTGTTCTCTGGCTCCCTTTAAAGGCCATTTTTGTCCTTTGCAAGGTTTGGTAGTCTCACCCTT

AGTTCGATGAAATTCCCTACAACTCCTCTCAAAGCACTCTACCTGGGTCCGGACACCCAGTCCCCAGGGCCAACCTACAAGTGAAGGAGACAGGTCTCTA

GGGTAGAGGGAAGCAGGCAGGAACCTCCCTGTCCTGATCTTAGAACAGTGGAAGTGAAGAACACCCCACACTCTCTAGCTTTAGAATACTGGGGTTTTGG

TTTTGGTTTTTTAAATTGCAGTTGTTTTAAGAAATTCAACCTTTCAGACCAGCCCTTCCACTAAACTTTGATTCTTTTTCTTTACTGCTTTTTTAAACCT

AAAAAAAAAAAAAAAAGAAAAAAAAAGGAAAGAAAGCAAGCGCACTCAGTGACTCCCCCACCTTGGTCTGTGGGAATGCCCGCCCGCACTCTGCCGTCCA

TCCTCCTCCCTTCTCCTCATGCAGTGTCTGTGAAGTAGTTTTATCTGTTTCTTAGGATGAAAAACGGCAATCATCCCACCAGGTGCTGGAAACTGGTCAG

CCTTGAAGCAGGCACTTCTGGGACCACAGCTCAGGGATGTGTATTTAATTACAGGGTCCCCAGAAAGCCTCTCTTGGCTGCCACAAGTAGCATCTTTCCT

GGACTTGGAGTCAGACCCTGACAACTTCCTCTGAGTGAGCAGCCCCAGGCCACTGAACTGAACGCAAGCTTGCCTATGGGTCTGGGCTTCCTCAAGACTT

TTGACCGTCTTACACGTGAGCTTCTCTAGTGCTCATGAGAAGCCTAGACCCTTTGCCCAGGGTCTTATCTGGCAGTCCTAAGTACACCCAGCTCGCTTGG

GTATCAGCTGTAGGCTCAAATGGAAGCTGTGGGAAAGGCTAAGGCCTGCTCCAAACCCAAGAAAAATGTGCTACTGGTGGAAGCTAGTCTTCTAACCTGG

AAGCCAGCCAAAGGGTTCTCTTGCTCTTTGCTGACCTTTTTCTTAGCCGAAATATAATAGGTGATAATGTTTTTTACTCAAATTTCCATGGGGGAAAAAA

GACTACCTCTTGAGTGACATCCTGGTCGATTCCTCTCTGAGGAGTCCTGTGGGAAAAGAATACTGTAGCTCCCGTGCTGTTTACATGTTTCTGTCGGGAA

TGAAACCCTGGACTGTTGTGTTTTTGTCTGTGTTGCCATCCCAGGCCTGTGATAGGAGCTTGTGGCTGTATTGTAATGTCTGGGCAGTGTCTGGGGAGTC

CTTTTCACCTGCCCAAATAGGGACAAGCCATCGCTAGAAGAGGCCTCCACCCCCTTCCTATGCTCCATAGCTTGGATTTCAGGGACTCTGATGGCAAGTG

CATCATGAACCTACCTCAGGCTACCTCCCAGTCCTCCCACAGTCCTATGTAGGAATCGAATGAATGGATGTCTCTGAGCCCTTGTTCCCAAAGGGCCGGC

CAAGGGCTGCCTGCCAGCCTGGCTCCATCAACCCTGCATGACCAAATGATAGTTGGCGGGCTCTGCAGGCTGCTCAGGCCCTCTGCTACCTCCCACACTT

GCCTGCTGGCAAGGGGTGGGCCCTGTTCTGTGAATTGACTACCTGTGGAAATGTGACCAATTAGTATGAAATGCATGTTTAGCAAGTATTAGGTACTGTA

TTTGAACCAATAAATGTGAATCCTCTGCACATG
Translation
 - UNI35996 - MERDERPPSGGGGGGGSAGFLEPPAALPPPPRNG - UNI15829 - - UNI35996 - GFCQDELAELDPGTN - UNI5314

 - NGETDSLTLGQGHIPV - UNI5735 - - UNI13761 - VSVPDDRAEQRTCLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNC

VMSRKQRNRCQYCRLLKCLQMGMNRKA - UNI6449 - AIREDGMPGGRNKSIGPVQ ISEEEIERIMSGQEFEEEANHWSNHGDSDHSSPGNRASES

NQPSPGSTLSSS SRSVELNGFMAFRDQYMGMSVPPHYQYIPHLFSYSGHSPLLPPQARSLDPQSYSLIHQLMSAEDLEPLGTPMLIEDG GYAVTQAEL

FALLCRLADELLFRQIAWIKKLPFFCELSIKDYTCLLSSTWQELILLSSLTVYSKQIFGELADVTAKYSPSDEELHR RFSDEGMEVIERLIYLYHKFHQ

LKVSNEEYACMKAINFLNQD DIRGLTSASQLEQLNKRYWYICQDFTEYKYTHQPNRFPDLMMCLPEIRYIAG GKMVNVPLEQLPLLFKVVLHSCKTST

VKE
Transcript ENSMUST00000076275
Sequence
ATGGAGCGGGACGAACGGCCACCTAGCGGAGGGGGAGGCGGCGGGGGCTCGGCGGGGTTCCTGGAGCCGCCCGCCGCGCTCCCTCCGCCGCCGCGCAACG

 - UNI15829 - - UNI35996 - GTTTCTGTCAGGATGAATTGGCAGAGCTTGATCCAGGCACTA - UNI5314 - ATGGAGAGACTGACAGTT

TAACACTTGGCCAAGGCCATATACCTG - UNI5735 - - UNI13761 - TTTCCGTCCCAGATGATCGAGCTGAACAACGAACCTGTCTCATCTGT

GGGGACCGCGCTACGGGCTTGCACTATGGGATCATCTCCTGCGAGGGCTGCAAGGGGTTTTTCAAGAGGAGCATTTGCAACAAACGGGTGTATCGGTGCA

GTCGTGACAAGAACTGTGTCATGTCCCGGAAGCAGAGGAACAGATGTCAGTACTGCCGCCTGCTCAAGTGTCTCCAGATGGGCATGAACAGGAAGG - U

NI6449 - CTATCAGAGAAGATGGCATGCCTGGAGGCCGGAACAAGAGCATTGGACCAGTCCAG ATATCAGAAGAAGAAATTGAAAGAATCATGTCTG

GACAGGAGTTTGAGGAAGAAGCCAATCACTGGAGCAACCATGGTGACAGCGACCACAGTTCCCCTGGGAACAGGGCTTCAGAGAGCAACCAGCCCTCACC

AGGCTCCACACTATCATCCAG TAGGTCTGTGGAACTAAATGGATTCATGGCATTCAGGGATCAGTACATGGGGATGTCAGTGCCTCCACATTATCAATA

CATACCACACCTTTTTAGCTATTCTGGCCACTCACCACTTTTGCCCCCACAAGCTCGAAGCCTGGACCCTCAGTCCTACAGTCTGATTCATCAGCTGATG

TCAGCCGAAGACCTGGAGCCATTGGGCACACCTATGTTGATTGAAGATGG GTATGCTGTGACACAGGCAGAACTGTTTGCTCTGCTTTGCCGCCTGGCC

GACGAGTTGCTCTTTAGGCAGATTGCCTGGATCAAGAAGCTGCCTTTCTTCTGCGAGCTCTCAATCAAGGATTACACGTGCCTCTTGAGCTCTACGTGGC

AGGAGTTAATCCTGCTCTCCTCCCTCACAGTGTACAGCAAGCAGATCTTTGGGGAGCTGGCTGATGTCACAGCCAAGTACTCACCCTCTGATGAAGAACT

CCACAG ATTTAGTGATGAAGGGATGGAGGTGATTGAACGACTCATCTACCTATATCACAAGTTCCATCAGCTGAAGGTCAGCAACGAGGAGTACGCATG

CATGAAAGCAATTAACTTCCTGAATCAAG ATATCAGGGGTCTGACCAGTGCCTCACAGCTGGAACAACTGAACAAGCGGTATTGGTACATTTGTCAGGA

TTTCACTGAATATAAATACACACATCAGCCAAACCGCTTTCCTGATCTTATGATGTGCTTGCCAGAGATCCGATACATCGCAG GCAAGATGGTGAATGT

GCCCCTGGAGCAGCTGCCCCTCCTCTTTAAGGTGGTGCTGCACTCCTGCAAGACAAGTACGGTGAAGGAGTGACCTGTGCCCTGCACCTCCTTGGGCCAC

CCACAGTGCCTTGGGTAGGCAGCACAGGCTCCAGAGGAAAGAGCCAGAGACCAAGATGGAGACTGTGGAGCAGCTACCTCCATCACAAGAAGAATTTGTT

TGTTTGTCTGTTTTTAACCTCATTTTTCTATATATTTATTTCACGACAGAGTTGAATGTATGGCCTTCAACATGATGCACATGCTTTTGTGTGAATGCAG

CAGATGCATTTCCTTGCAGTTTACAGAATGTGAAGATGTTTAATGTTACCGTGTTGTCATTGTTTAGAGATAGGTTTTTTTGTATTTTGAGGGAGAGGGT

AGGATGGACTAGATGAGTATTTCCATAATGTTGACAAAGACAACTACCTCAATGGAAACAGGTGTATGACCATCCCTACCTTTTCCACATTTTCTCAGCA

GATACACACTTGTCTGTTAGAGAGCAAACTGCCTTTTTTATAGCCACAGACTTCTAAGTAAAAGAAGCAAACAAAGGAGCGAAGTGGTATAGGGAGATTT

ACTAATGGCCAGTGGGACATCTGAGAGGCAATTTGATTTTGATCATCTCATCCCACAAGCCTGAAGGGCAGAAACTCTGCCTTACCTTCTGCTGCACCCC

TCCCCCACACGCTGTTGTCTGTTGATGCTGCTGTCAAGTTTTCATCCAGGTAGAGTCCTAACAATAAGCCAGTATGTAGGACTTGCCTCCCAGCGCCCTT

GTAGCTCATAGCTGCCTAGTTTGCTGTTCTAGATCTACCAAGGCCTACCTTCTTCAGACCCCATCCCTACCTCTTATGAATTTGACTTCCTGTCAGTCCT

TTAGAAAGGGACAGGAAAATGCCATGTTCTGAATTCTGATGCCATTTCTGATTTGTTTTTTACATTGTTTCCCTCAAAAGGTAGAGGGGCAAAGACCAGG

CTGCTGAAAGAATAAAGACTTCTTTGGAAGTCGCTGTTCTCACCCAACCTTATCCTCTGAACCAAATCCAAAATCCAAAACTGCCACTTTTAAACAGTAG

AAAGGACCAGAAACTTTGCTGCAAATTTTTGTTGTAAGTTCTCCCATTAGTCCCAAAATGAGATTTGTTTGCCAGGGTCTAGAACAGAAAGTCAAGACCC

AGAGAAGCCCAGCTCTTCCTTCAAGTATTATCAGGGATCTAACCTACCAAGGTTTGGAGGGATGGAGCCAGAAAGACCTAGAAAGGAAAGGGGCATTAAA

CTACCTCATGTTTCTAAGGGCTAGGCTGCTGCTCTGCAGCTGCAGCCTGGGCCCCTGTGCTTTACTGCCTACCCCATCTAGTTCTAGGAAGAGTTTTTAC

CCTCCAGACTTTGGCCAGACCAACTAGGTTTGTCTTAGAGCTGTTTCAGCTGCTTTTCCCTTTCTTTGTACCAGGCTCTCCTACCACTAGTACCCCAGAC

ACATGCTCCACTGGCTGGTATCTCGTGCTGGGTCTGCCTCACCCACAGTATCTTTTTTAGCCTGTTTTGTCAGGAACTGTTTACACTTCCCCAGTGAAGC

CTATTAACTTACCCTGGAGACAACAGCATCCTGTGCCTCCTAGGTAGTGCCTCCATTTGTCAGTTTTTCTCTTTAGTGAAATGATACAGGTACCAGCAAA

GTGACAATATGTCCTTTGATGTCCAAAGTTCAGAACATTATTTCTTCTCATTCTTATTCCCCAGCCACTTGAGAGAGAAAAAGTTCCAGATAGAATGTTT

TTCACGTTTGTGGGAAGATATATGTATTGATGTGTCTGTTTCTGAGCTCACAATATTTTCATGTTTGCCTGAATTTTTATATTTAACCAACCAGATCATG

TTATTTGGCTCTGGGTCAGATTCTCAGCTGCTTTCCTCAAGCTAGAAATCAGAGACACAGTTCAGAGACAGCACCTCTGTGCACACAGCAGCCTTCTTTG

CTTAGACTTCCATTTATCAAATTGGTACTTTTTTAAATTGCTTTTCAAATTAGCATTTTACCTGTTGTGTTGAATGTCAAAGCTCTGATGAGACAAGAAC

ATATCTTTCCAATAATGTAGTATTAAACAGAGCAAGTTGTTAATTTGTAGAGTGGGGGAAAGGTTCTGCAAGTTGCCATTGTACAAATCCATTTTTACAA

ATGTTTGCAGCAGATTCCACAGAACAAAGAGCCCATTCATTGCCAAGAGCCCTGCAGAATCTCTGAGCCAAGTGGCTGTGTGTTCCGAGCTGGAGCCTGA

CCTGTGGACCGCCTTTAATGTCTTCTGCACCCAGTCCTTTTATGACATGGGCTTCTTTTAAACAGGGTAAAGTAAATGGGCTGCTTTGCAAACTCAGGTA

TTATGAGGAGAAGGTAGGAGTGTAGCTAGCAGCGTGGAGACATTAGGTCAGCCACTAGATGTATTTGTGATTTTGGTTTGAAGGACACAGAGAAAGGTTG

GAGGAGGAGGTTTGGTATGCTTGTTTTTTGCCTTTTTTCCTATAATGTTTGATTAACAGGCAGCCTTTTAGCTAGTGGAAGAAGGAAAAACTTGTGCATG

CTATATCTCATTCCCCCCTCTCTCTCTCCTGTCCTCTCTGATCCAGACCACCAAAAATACTCACTTTGAGTGAGAATTTTTCAACCATAAAAACATATAG

CCCCCAAAGCCATGTGGAGAAGGAGAGCCCACCTCCTTGCACTGTGCTGAAACATAGAGGTTTCCCCCTGCCTTTTCTTATGTATGCTTTCTTGACCCAA

GGCAGAAGTGTGGAGTCTTAGAGCTTTGTAATTCCTGTTCTCTGGCTCCCTTTAAAGGCCATTTTTGTCCTTTGCAAGGTTTGGTAGTCTCACCCTTAGT

TCGATGAAATTCCCTACAACTCCTCTCAAAGCACTCTACCTGGGTCCGGACACCCAGTCCCCAGGGCCAACCTACAAGTGAAGGAGACAGGTCTCTAGGG

TAGAGGGAAGCAGGCAGGAACCTCCCTGTCCTGATCTTAGAACAGTGGAAGTGAAGAACACCCCACACTCTCTAGCTTTAGAATACTGGGGTTTTGGTTT

TGGTTTTTTAAATTGCAGTTGTTTTAAGAAATTCAACCTTTCAGACCAGCCCTTCCACTAAACTTTGATTCTTTTTCTTTACTGCTTTTTTAAACCTAAA

AAAAAAAAAAAAAGAAAAAAAAAGGAAAGAAAGCAAGCGCACTCAGTGACTCCCCCACCTTGGTCTGTGGGAATGCCCGCCCGCACTCTGCCGTCCATCC

TCCTCCCTTCTCCTCATGCAGTGTCTGTGAAGTAGTTTTATCTGTTTCTTAGGATGAAAAACGGCAATCATCCCACCAGGTGCTGGAAACTGGTCAGCCT

TGAAGCAGGCACTTCTGGGACCACAGCTCAGGGATGTGTATTTAATTACAGGGTCCCCAGAAAGCCTCTCTTGGCTGCCACAAGTAGCATCTTTCCTGGA

CTTGGAGTCAGACCCTGACAACTTCCTCTGAGTGAGCAGCCCCAGGCCACTGAACTGAACGCAAGCTTGCCTATGGGTCTGGGCTTCCTCAAGACTTTTG

ACCGTCTTACACGTGAGCTTCTCTAGTGCTCATGAGAAGCCTAGACCCTTTGCCCAGGGTCTTATCTGGCAGTCCTAAGTACACCCAGCTCGCTTGGGTA

TCAGCTGTAGGCTCAAATGGAAGCTGTGGGAAAGGCTAAGGCCTGCTCCAAACCCAAGAAAAATGTGCTACTGGTGGAAGCTAGTCTTCTAACCTGGAAG

CCAGCCAAAGGGTTCTCTTGCTCTTTGCTGACCTTTTTCTTAGCCGAAATATAATAGGTGATAATGTTTTTTACTCAAATTTCCATGGGGGAAAAAAGAC

TACCTCTTGAGTGACATCCTGGTCGATTCCTCTCTGAGGAGTCCTGTGGGAAAAGAATACTGTAGCTCCCGTGCTGTTTACATGTTTCTGTCGGGAATGA

AACCCTGGACTGTTGTGTTTTTGTCTGTGTTGCCATCCCAGGCCTGTGATAGGAGCTTGTGGCTGTATTGTAATGTCTGGGCAGTGTCTGGGGAGTCCTT

TTCACCTGCCCAAATAGGGACAAGCCATCGCTAGAAGAGGCCTCCACCCCCTTCCTATGCTCCATAGCTTGGATTTCAGGGACTCTGATGGCAAGTGCAT

CATGAACCTACCTCAGGCTACCTCCCAGTCCTCCCACAGTCCTATGTAGGAATCGAATGAATGGATGTCTCTGAGCCCTTGTTCCCAAAGGGCCGGCCAA

GGGCTGCCTGCCAGCCTGGCTCCATCAACCCTGCATGACCAAATGATAGTTGGCGGGCTCTGCAGGCTGCTCAGGCCCTCTGCTACCTCCCACACTTGCC

TGCTGGCAAGGGGTGGGCCCTGTTCTGTGAATTGACTACCTGTGGAAATGTGACCAATTAGTATGAAATGCATGTTTAGCAAGTATTAGGTACTGTATTT

GAACCAATAAATGTGAATCCTCTGCACATG
Translation
MERDERPPSGGGGGGGSAGFLEPPAALPPPPRNG - UNI15829 - - UNI35996 - GFCQDELAELDPGTN - UNI5314 - NGETDSLTLGQ

GHIPV - UNI5735 - - UNI13761 - VSVPDDRAEQRTCLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNCVMSRKQRNRCQYCR

LLKCLQMGMNRKA - UNI6449 - AIREDGMPGGRNKSIGPVQ ISEEEIERIMSGQEFEEEANHWSNHGDSDHSSPGNRASESNQPSPGSTLSSS S

RSVELNGFMAFRDQYMGMSVPPHYQYIPHLFSYSGHSPLLPPQARSLDPQSYSLIHQLMSAEDLEPLGTPMLIEDG GYAVTQAELFALLCRLADELLFR

QIAWIKKLPFFCELSIKDYTCLLSSTWQELILLSSLTVYSKQIFGELADVTAKYSPSDEELHR RFSDEGMEVIERLIYLYHKFHQLKVSNEEYACMKAI

NFLNQD DIRGLTSASQLEQLNKRYWYICQDFTEYKYTHQPNRFPDLMMCLPEIRYIAG GKMVNVPLEQLPLLFKVVLHSCKTSTVKE

For any suggestions or comments, please send an email to unitrap@crg.es