Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000064061 (Dzip3)
Chromosomal location
Chr 16: 48924345 - 48994278 (-)
Description
DAZ interacting protein 3, zinc finger Gene [Source:MGI (curated);Acc:Dzip3-001]
RefSeq_dna
NM_027341 
RefSeq_peptide
NP_001103487.1 NP_081617.1 
UniGene
Mm.407401 
MGI
MGI:1917433 
Uniprot/SWISSPROT
Q7TPV2 
Uniprot/SPTREMBL
Q148V3 
Human Ortholog
ENSG00000198919 (DZIP3)
Omim not available
UniTrap UNI15421
Vector Insertion
Chr 16: 48984647 - 48994055
Public Clones (sanger) P102F11 (ggtc) H003D03 (ggtc) PST7173-NR (escells)
Private Clones OST304264 (lexicon) OST277053 (lexicon) OST194712 (lexicon) OST165455 (lexicon)
OST67849 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24384
Vector Insertion
Chr 16: 48982246 - 48984647
Public Clones not available
Private Clones OST222671 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34407
Vector Insertion
Chr 16: 48961220 - 48972450
Public Clones IST12995F9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19776
Vector Insertion
Chr 16: 48953917 - 48957765
Public Clones not available
Private Clones OST380902 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5379
Vector Insertion
Chr 16: 48948690 - 48950113
Public Clones SYA225 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2265
Vector Insertion
Chr 16: 48945737 - 48947787
Public Clones AK0181 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8265
Vector Insertion
Chr 16: 48931407 - 48933906
Public Clones RRF115 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000121869
Sequence
TCCTGTTCCGGTCGGACTCCGGAAGTCTGGGAGCAGCGGGTGGGACTGCAGTCGGTGATTGGCAGGGTGGGCCTGGGTTCCAGGCGCTGGGGTTGCGGGA

AGGTGGCAGGGAGCCATCCCCTCCCACCCCCGCCGCAGTCCCCCTTTGGCGGAGAGGCCGCGAGGTTTCGGCTGGAGGTCCGCGAACACGCGGGAATCTC

GCGAGACGAGCTCGTGCGGGCTCATTCTGTGGAGGGCTTCTGGGGCGAACGGGGGTCTCCGTGCCGCGCGGGCTCGGTCCCCGGGCCTTCCTCGGCCTGG

GCGCGGCGGGCTCGGCTTTCCGTGCGTGCCTCAGCCTCTGCCCGAGACACGGCCGCTCCCCCCTAGTCTAGACACG - UNI15421 - CTTTTATGAC

CATAGCAAAAATCAGTTTGCAGGCATTGGAATAAATCTTGTAAAGGAACATTGTGCAACATGGATTCTCTAGCAGAAGAATTTTTTGTAAG - UNI154

21 - - UNI24384 - TGGAAATCCTGATGTGGAGGAACAGACCAAGGAAGAAACTGAGATTATAGCAGAGAAACCAGTCACTCAGCTG GACAAACA

GAAAATGGATATATCTGCTGATCCTGAGCCTGTTAACGCACTATTAGAAATAAAGAAGGTATTAAATCCAATCAGTGCTCTTCCCAAAGGTGTGTTCCCT

AACATTGAAAAGTTCATACAAGAAGATTTCTCTTTCCAGACTATGCAG AGGGAAGTTACAACTCATAGCCAGACTGGGGAAGAAATTGTTCCTGCTCTA

ACATTACATTTTTTGATAACACAACTGGAAATGGCACTTAGAAACATTCAAGCTTCTAATTATACT GCACAACAAATTAATGTTGGTTATTATTTGACA

TTACTATTTTTGTATGGAGTGGCACTCACTGAAAGAGCAAAGAAAGAG GACTGCATAGAAGCTGAAAATAAATTTCTGGTGATGAAGATGGTGATCCAA

GAAAGTGAGATTTGTGAAAACTTTATGTGTTTAGTTTATTTTGGACGTGGTTTACTTCGATGTGCTCAGAAGAG - UNI34407 - ATATAATGGAGC

ACTACTAGAATTTTACAAAAGCTTACAAGAAATAGGAGATACAGATGATAATTGGTTTGAAGTAGATCCTACAGATGATGAAGATTTACCTACAACCTTC

AAA - UNI34407 - GATAGTCTCAATAATTTTATCAAAACAACTGAAAGTAATATAATGAAAGAGACCATTTGCAGTTATCTTGATTGTGAGCGTTC

TTGTGAAGCTGACATTTTAAAGAACACCAATTATAAG - UNI34407 - GGATTTTTCCAGCTAATGTGCAGTAAAAGTTGCTGTATTTACTTCCATA

AAATTTGTTGGAAAAAGTTCAAGAACTTAAAGTATCCAGGAGAAAGTGATCAG AGTTTTAGTGGGCAAAAATGTTTGAAAGAAGGATGTCCAGGTGACA

TGGTCAGGATGCTACAATGTGATGTGCCTGGAATTGTCAAAATTTTG TTTGAAGTGGTGAGAAAGGATGAATATATAACCATTGAAAACTTAGGAGCAA

G - UNI19776 - TTACAAGAATTTGATGTCTCTGGAACTAACTGACACTGATATTAGACCGAAATTCAATTTAAAACCAAACACAAAAG ATGAAGT

GCCTATCTTCAAACTTGATTATAATTATTTCTATCATCTGCTTCATATAATTATTATTTCTGGTACTGACATGGTCCGGCAAATATTTGATGAGGCTATG

CCACCCACTCTTTTGAAAAAAGAGCTGCTTATACACAAGAATGTGCTGGAACCCTACTACAATCATCTTTGGACCAATCACCCTTTGGGTGGATCATGGC

ATCTGCTTTACCCCCCAAACAAGGAGCTACCACAGTCCAAACAGTTTGACTTATGCCTCTTATTAGCGCTCATTAAACATCTGAATGTATTCCCTGCACC

CAGAAAAGGCTGGGATATGGAACCACCATCTTCTGATCTCTCTAAGTCTGCAGACATTCTGAGGCTCTGCAAGTACAGGGATATCCTTCTCAGTGAGATT

CTGATGAATGGTCTCACCGAGTTACAGTTCAATTCAATTTGGAAAAAAGTTTCTGATATTCTTCTGCGCCTTGGGATGAAACAAGACGATATTGACAAAG

TCAAGGAGAATCCCATTGAGAATATCTCCCTTGATTATCATCAGCTGTCCATTTATCTAGGCATACCAGTACCAGAAATCATCCAGAGGATGTTATCCTG

CTATCAACAAG GAATTACTCTACAGTCAATAACAGGCAGTCAGC - UNI5379 - GTTTAGATGTAGAAGAGTTCCAGAATGATGAAGAAGACTTGA

GTCCACCTGTGATGGAATATAATATCGATGTGAAATCAAACACTGAGATACAGTTAGCAGAGATAAATAAAGATGTAGCCTCGATACCTAGTGAATCTTC

AACAGAATCTGTTAAAGATCTTCAGGAG GTCAAAAGTAAAACAAAGAAGAAGAAAAGAACTAAGAGTAATAAAAAG - UNI2265 - GATAAGGATT

CAGAAGATGAGCAAGT CTCATATATGGTAGAAAAGGACGACCAGCTGGAGACAGAACAAGTAGACGTGAACACACTCAGTACATACATGAAAACTGATA

CAAGTGATGCACAAGAAGATTCTGCAGCTGAGGACAAGTTCTGTAGCCTGGATGAACTGCATATTCTAGATATGGTAGAGCAG GGCTCATCTGGAAAGG

AAAGTACAGACTTCAAAGAAACTGAAAAGGAAAGGCTTGCTCATCAACATCAGCTTTATAAATTGCAGTATGAATGTGAA GATTACAAAAGGCAACTGA

AAACAGTGACATTTCGGTGGCAGGAAAATCAAATGCTGATCAAAAAGAAAGAAAAGATTATTGTATCTCTTAACCAACAAGTGGCTTTTGGGATCAATAA

AATGTCCAA ATTACAGCGCCAAATCCATGCTAAAGATGATGAAATCAAGAACCTTAAAGACCAACTTTCCTTGAAAAG ATCTCAGTGGGAAATGGAGA

AGCATAATCTGGAAAGCACAGTTAAAACATATTTAAACAAACTAAATGCAGAAACCAGCAGAGCCTTAACAGCCGAG GTGTACTTTTTACAGTGTCGTA

GAGACTTTGGTTTACTACACCTCGAGCAGACAGAAAAAGAGTGCCTCAATCAGCTGGCCAGGGTGACACACATGGCAGCAAG CAACCTAGAATCACTTC

AACTAAAAGCTGCTGTAGATAGTTGGAATGCTATTGTGGCGGATGTTCGAAACAAGATTGCATTCCTCAGG ACACAGTACAATGAACAGATCAACAAGG

TTAAGCAGGGGTTTGCCTTGAGTACCTTGCCTCCAGTCCAGCTTCCTCCACCACCACCAAGTCCTGAGATACTG - UNI8265 - ATACAGCAATTCT

TAGGAAGACCCCTTGTGAAGGAATCTTTCTTTCGACCCATACTTACTGTCCCTCAAATGCCTGCAGTTTGCCCTGGAGTCATCTCTGCAGCTGTACAACC

TAGACCACCCCTG ATGCCTGGTATAACCTGGGCTATGCCAACACCTATAGGTGATACTGTGTCACCGAGTGCAAGTCTGTGCAGTGAACCTCTCATGAT

AAACTGGGAGAGGATTACAGACAGGCTGAAAACTGCTTTTCCACAACAGACAAG GAAAGAGCTAACAGATTTCTTACAACAGTTAAAGGATTCTCATGG

AAAGTCCGTGTCTCGACTGACATTTGATGAAATTGTTTACAAAATTTCTCAAATGATTGAGCCCAAGAAATCTGAG AGTGAAGAAAAGTCTGCTCAAGA

TGGCAATAATGCTTCACCCAGCCACACTGCATCACAGCCTAATGCTCCCCAGGACCCCAAGTCAGCACAAGGTTCTGCCACATGGGAAGGAGACAAAGAC

ATG GATAATGAAGAGGAAGAAGAGGAGCCTTGTGTAATCTGTCATGAGAATTTGTCTCCAGAAAACCTTTCAGTTTTGCCTTGTGCTCACAAATTTCAC

TCTCAG TGCATTAGACCATGGTTGATGCAACAGGGCACATGCCCCACCTGCAGACTCCATGTTTTGCAACCAGAAGAATTCCCTGGCCACCCCAACGGG

CAGTTACCCAAGATCTGATACAAGGCAGGTAGCTATACCTAAGATCAGCTTTAGACACTGGGATTTAGTTCTGCTTTTTAATGAGCTAATTGTTTGAACA

GTATTATGCAGCAGCATGTGCCTTGACCAGCTAATCAAACCAAAGCTGAGTCAAAGAGATTGAGACAGATCTACAGCACGTGTAATTAAATGGAAGAGAC

TAAAGAACATGGATTTTATTGCTTTTTGTAAGATTTTCCATCTGTAAACACAAGGCCTGTAAACATGACTATCAGTATATTTCTTAGAATGTCCTGCCTT

TTCAGCCTTTTTTCTTCCTTCTTATTCTATTGTCTTTTCCTTTCTCTCAAGTATGATATATTTTATTTTCATGAAATGAGTTTAATAGAACAAGTAGAAG

GGTAGGAAATTTCTATAGACTTTAGTTTTCTTAACTTTGAAAGCTTAGTATTAAAATATAATTATTGTAAGTTATATTTCTATCTTCTGAAATGGCCATA

CTTGCTAAGATTATGGACTTTGACACTGGTGACCATACAATGGTTTGTAATAGCTTGGGAGAGGTGATTATTATTTTTCAGACAGTACAGATCGTTTGTC

AACTTGTTGTTGCCATGCAATTTCCACAATAACTATACTGTAGAAACTGCAACTAAGATTCTCCTTTCCCCCAAGAGCTAGTTCTTAAAAATTACACCAC

AAGATGTCTATATTCCCAATATTTAGCAAAATAAATATAGAATGAAGTTAGAATTTGAAATCAAGAGGTAATAAAAGGGGCAGATATGCAAATTAAGTTA

TTTGCTGGGATAAGTAATTGAAGTTTTACATTCCTTTGTAAACATACTCTTTGGTTCTTAGTCATTTACATTTGGAGTAATTAGAGGTTTTTGTTGTTGC

TGTTTTGTTTTGTCTTCGTCTTTAAAAGTGTCTCCTTTATGTAGTTGTTCTGGGGAAGAGAAGAAGCCATTATATGTATTGCTGCTGCTTATGACAGAGT

TGATATCCACTAAGGCCAGTTGTCTATCAAAGCTTAAGTTTCAATTCTTAGACAATAAAGCCTATTTTAAAAACTAGTGTAAATACCTGTAAGTATTGTA

CATGCCTGTACCTTCAAATGTAAAGTAAGCCACGGTACCTTGTGAGACATGTGTTCCTTGTGTTCCTTGGTTCATATTCACAATCTCAACTTTATTAATT

TGGGGGGAAAGGTTTTTTGACTCAGCAACTATTTTGTCTGTATATTTCAGTGTAAATGTATCTTGAAGTTACTGTGAATCTCTATTTAAAAAGTCAATGC

GTGTAATTGTATGCTAAACTTCTTTTTTTATTTTGAAATCAAACTGAAAAATATGAAGAAAAATAATTTTAAAATTTCAACATCTGAGGGGGTAAGTTGA

CTTGGCAGGTAATGGTGCTTGTTGCAGAGTTTGCTGACCTGAGTTCTATTGCTGGGACCTGCATGCTGAAAGGAACAAACCAATAGTTCACAAATTTTCC

ACTAACTTTCATGTGTACATTGTGGCTTTTGTGTGTACATGCACACAGTACTCATAGATGTACAAAAGAAAAAGAAAAGAAAGAGAATTTTTTAAATATG

CCATTTGTCCATATATAAAATACCAACATTGTGTTTGAATTGCAAAAATCTAGAACTTATGGGACATTTAATCATTATGTTATCATGGTTATGTAGCAAG

TTACCTTGTAAGATTTAGTTCTTGCTTGTAATTGTAATTTCATTTTTATGTGGAAAATAAAAATATTTCTGAATTGAA
Translation
 - UNI15421 - MDSLAEEFFVS - UNI15421 - - UNI24384 - SGNPDVEEQTKEETEIIAEKPVTQL DKQKMDISADPEPVNALLEIKK

VLNPISALPKGVFPNIEKFIQEDFSFQTMQ REVTTHSQTGEEIVPALTLHFLITQLEMALRNIQASNYT AQQINVGYYLTLLFLYGVALTERAKKE D

CIEAENKFLVMKMVIQESEICENFMCLVYFGRGLLRCAQKR - UNI34407 - RYNGALLEFYKSLQEIGDTDDNWFEVDPTDDEDLPTTFK - UNI

34407 - DSLNNFIKTTESNIMKETICSYLDCERSCEADILKNTNYK - UNI34407 - GFFQLMCSKSCCIYFHKICWKKFKNLKYPGESDQ SFS

GQKCLKEGCPGDMVRMLQCDVPGIVKIL FEVVRKDEYITIENLGAS - UNI19776 - SYKNLMSLELTDTDIRPKFNLKPNTKD DEVPIFKLDYN

YFYHLLHIIIISGTDMVRQIFDEAMPPTLLKKELLIHKNVLEPYYNHLWTNHPLGGSWHLLYPPNKELPQSKQFDLCLLLALIKHLNVFPAPRKGWDMEP

PSSDLSKSADILRLCKYRDILLSEILMNGLTELQFNSIWKKVSDILLRLGMKQDDIDKVKENPIENISLDYHQLSIYLGIPVPEIIQRMLSCYQQG GIT

LQSITGSQR - UNI5379 - RLDVEEFQNDEEDLSPPVMEYNIDVKSNTEIQLAEINKDVASIPSESSTESVKDLQE VKSKTKKKKRTKSNKK - U

NI2265 - DKDSEDEQV VSYMVEKDDQLETEQVDVNTLSTYMKTDTSDAQEDSAAEDKFCSLDELHILDMVEQ GSSGKESTDFKETEKERLAHQHQL

YKLQYECE DYKRQLKTVTFRWQENQMLIKKKEKIIVSLNQQVAFGINKMSK KLQRQIHAKDDEIKNLKDQLSLKR RSQWEMEKHNLESTVKTYLNKL

NAETSRALTAE VYFLQCRRDFGLLHLEQTEKECLNQLARVTHMAAS SNLESLQLKAAVDSWNAIVADVRNKIAFLR TQYNEQINKVKQGFALSTLPP

VQLPPPPPSPEIL - UNI8265 - IQQFLGRPLVKESFFRPILTVPQMPAVCPGVISAAVQPRPPL MPGITWAMPTPIGDTVSPSASLCSEPLMINW

ERITDRLKTAFPQQTR RKELTDFLQQLKDSHGKSVSRLTFDEIVYKISQMIEPKKSE SEEKSAQDGNNASPSHTASQPNAPQDPKSAQGSATWEGDKD

M DNEEEEEEPCVICHENLSPENLSVLPCAHKFHSQ CIRPWLMQQGTCPTCRLHVLQPEEFPGHPNGQLPKI
Transcript ENSMUST00000114516
Sequence
TTCTGTGGAGGGCTTCTGGGGCGAACGGGGGTCTCCGTGCCGCGCGGGCTCGGTCCCCGGGCCTTCCTCGGCCTGGGCGCGGCGGGCTCGGCTTTCCGTG

CGTGCCTCAGCCTCTGCCCGAGACACGGCCGCTCCCCCCTAGTCTAGACACG - UNI15421 - CTTTTATGACCATAGCAAAAATCAGTTTGCAGGC

ATTGGAATAAATCTTGTAAAGGAACATTGTGCAACATGGATTCTCTAGCAGAAGAATTTTTTGTAAG - UNI15421 - - UNI24384 - TGGAAA

TCCTGATGTGGAGGAACAGACCAAGGAAGAAACTGAGATTATAGCAGAGAAACCAGTCACTCAGCTG GACAAACAGAAAATGGATATATCTGCTGATCC

TGAGCCTGTTAACGCACTATTAGAAATAAAGAAGGTATTAAATCCAATCAGTGCTCTTCCCAAAGGTGTGTTCCCTAACATTGAAAAGTTCATACAAGAA

GATTTCTCTTTCCAGACTATGCAG AGGGAAGTTACAACTCATAGCCAGACTGGGGAAGAAATTGTTCCTGCTCTAACATTACATTTTTTGATAACACAA

CTGGAAATGGCACTTAGAAACATTCAAGCTTCTAATTATACT GCACAACAAATTAATGTTGGTTATTATTTGACATTACTATTTTTGTATGGAGTGGCA

CTCACTGAAAGAGCAAAGAAAGAG GACTGCATAGAAGCTGAAAATAAATTTCTGGTGATGAAGATGGTGATCCAAGAAAGTGAGATTTGTGAAAACTTT

ATGTGTTTAGTTTATTTTGGACGTGGTTTACTTCGATGTGCTCAGAAGAG - UNI34407 - ATATAATGGAGCACTACTAGAATTTTACAAAAGCTT

ACAAGAAATAGGAGATACAGATGATAATTGGTTTGAAGTAGATCCTACAGATGATGAAGATTTACCTACAACCTTCAAA - UNI34407 - GATAGTC

TCAATAATTTTATCAAAACAACTGAAAGTAATATAATGAAAGAGACCATTTGCAGTTATCTTGATTGTGAGCGTTCTTGTGAAGCTGACATTTTAAAGAA

CACCAATTATAAG - UNI34407 - GGATTTTTCCAGCTAATGTGCAGTAAAAGTTGCTGTATTTACTTCCATAAAATTTGTTGGAAAAAGTTCAAGA

ACTTAAAGTATCCAGGAGAAAGTGATCAG AGTTTTAGTGGGCAAAAATGTTTGAAAGAAGGATGTCCAGGTGACATGGTCAGGATGCTACAATGTGATG

TGCCTGGAATTGTCAAAATTTTG TTTGAAGTGGTGAGAAAGGATGAATATATAACCATTGAAAACTTAGGAGCAAG - UNI19776 - TTACAAGAA

TTTGATGTCTCTGGAACTAACTGACACTGATATTAGACCGAAATTCAATTTAAAACCAAACACAAAAG GAATTACTCTACAGTCAATAACAGGCAGTCA

GC - UNI5379 - GTTTAGATGTAGAAGAGTTCCAGAATGATGAAGAAGACTTGAGTCCACCTGTGATGGAATATAATATCGATGTGAAATCAAACAC

TGAGATACAGTTAGCAGAGATAAATAAAGATGTAGCCTCGATACCTAGTGAATCTTCAACAGAATCTGTTAAAGATCTTCAGGAG GTCAAAAGTAAAAC

AAAGAAGAAGAAAAGAACTAAGAGTAATAAAAAG - UNI2265 - GATAAGGATTCAGAAGATGAGCAAGT CTCATATATGGTAGAAAAGGACGACC

AGCTGGAGACAGAACAAGTAGACGTGAACACACTCAGTACATACATGAAAACTGATACAAGTGATGCACAAGAAGATTCTGCAGCTGAGGACAAGTTCTG

TAGCCTGGATGAACTGCATATTCTAGATATGGTAGAGCAG GGCTCATCTGGAAAGGAAAGTACAGACTTCAAAGAAACTGAAAAGGAAAGGCTTGCTCA

TCAACATCAGCTTTATAAATTGCAGTATGAATGTGAA GATTACAAAAGGCAACTGAAAACAGTGACATTTCGGTGGCAGGAAAATCAAATGCTGATCAA

AAAGAAAGAAAAGATTATTGTATCTCTTAACCAACAAGTGGCTTTTGGGATCAATAAAATGTCCAA ATTACAGCGCCAAATCCATGCTAAAGATGATGA

AATCAAGAACCTTAAAGACCAACTTTCCTTGAAAAG ATCTCAGTGGGAAATGGAGAAGCATAATCTGGAAAGCACAGTTAAAACATATTTAAACAAACT

AAATGCAGAAACCAGCAGAGCCTTAACAGCCGAG GTGTACTTTTTACAGTGTCGTAGAGACTTTGGTTTACTACACCTCGAGCAGACAGAAAAAGAGTG

CCTCAATCAGCTGGCCAGGGTGACACACATGGCAGCAAG CAACCTAGAATCACTTCAACTAAAAGCTGCTGTAGATAGTTGGAATGCTATTGTGGCGGA

TGTTCGAAACAAGATTGCATTCCTCAGG ACACAGTACAATGAACAGATCAACAAGGTTAAGCAGGGGTTTGCCTTGAGTACCTTGCCTCCAGTCCAGCT

TCCTCCACCACCACCAAGTCCTGAGATACTG - UNI8265 - ATACAGCAATTCTTAGGAAGACCCCTTGTGAAGGAATCTTTCTTTCGACCCATACT

TACTGTCCCTCAAATGCCTGCAGTTTGCCCTGGAGTCATCTCTGCAGCTGTACAACCTAGACCACCCCTG ATGCCTGGTATAACCTGGGCTATGCCAAC

ACCTATAGGTGATACTGTGTCACCGAGTGCAAGTCTGTGCAGTGAACCTCTCATGATAAACTGGGAGAGGATTACAGACAGGCTGAAAACTGCTTTTCCA

CAACAGACAAG GAAAGAGCTAACAGATTTCTTACAACAGTTAAAGGATTCTCATGGAAAGTCCGTGTCTCGACTGACATTTGATGAAATTGTTTACAAA

ATTTCTCAAATGATTGAGCCCAAGAAATCTGAG AGTGAAGAAAAGTCTGCTCAAGATGGCAATAATGCTTCACCCAGCCACACTGCATCACAGCCTAAT

GCTCCCCAGGACCCCAAGTCAGCACAAGGTTCTGCCACATGGGAAGGAGACAAAGACATG GATAATGAAGAGGAAGAAGAGGAGCCTTGTGTAATCTGT

CATGAGAATTTGTCTCCAGAAAACCTTTCAGTTTTGCCTTGTGCTCACAAATTTCACTCTCAG TGCATTAGACCATGGTTGATGCAACAGGGCACATGC

CCCACCTGCAGACTCCATGTTTTGCAACCAGAAGAATTCCCTGGCCACCCCAACGGGCAGTTACCCAAGATCTGATACAAGGCAGGTAGCTATACCTAAG

ATCAGCTTTAGACACTGGGATTTAGTTCTGCTTTTTAATGAGCTAATTGTTTGAACAGTATTATGCAGCAGCATGTGCCTTGACCAGC
Translation
 - UNI15421 - MDSLAEEFFVS - UNI15421 - - UNI24384 - SGNPDVEEQTKEETEIIAEKPVTQL DKQKMDISADPEPVNALLEIKK

VLNPISALPKGVFPNIEKFIQEDFSFQTMQ REVTTHSQTGEEIVPALTLHFLITQLEMALRNIQASNYT AQQINVGYYLTLLFLYGVALTERAKKE D

CIEAENKFLVMKMVIQESEICENFMCLVYFGRGLLRCAQKR - UNI34407 - RYNGALLEFYKSLQEIGDTDDNWFEVDPTDDEDLPTTFK - UNI

34407 - DSLNNFIKTTESNIMKETICSYLDCERSCEADILKNTNYK - UNI34407 - GFFQLMCSKSCCIYFHKICWKKFKNLKYPGESDQ SFS

GQKCLKEGCPGDMVRMLQCDVPGIVKIL FEVVRKDEYITIENLGAS - UNI19776 - SYKNLMSLELTDTDIRPKFNLKPNTKG GITLQSITGSQ

R - UNI5379 - RLDVEEFQNDEEDLSPPVMEYNIDVKSNTEIQLAEINKDVASIPSESSTESVKDLQE VKSKTKKKKRTKSNKK - UNI2265 -

 DKDSEDEQV VSYMVEKDDQLETEQVDVNTLSTYMKTDTSDAQEDSAAEDKFCSLDELHILDMVEQ GSSGKESTDFKETEKERLAHQHQLYKLQYECE

 DYKRQLKTVTFRWQENQMLIKKKEKIIVSLNQQVAFGINKMSK KLQRQIHAKDDEIKNLKDQLSLKR RSQWEMEKHNLESTVKTYLNKLNAETSRAL

TAE VYFLQCRRDFGLLHLEQTEKECLNQLARVTHMAAS SNLESLQLKAAVDSWNAIVADVRNKIAFLR TQYNEQINKVKQGFALSTLPPVQLPPPPP

SPEIL - UNI8265 - IQQFLGRPLVKESFFRPILTVPQMPAVCPGVISAAVQPRPPL MPGITWAMPTPIGDTVSPSASLCSEPLMINWERITDRLK

TAFPQQTR RKELTDFLQQLKDSHGKSVSRLTFDEIVYKISQMIEPKKSE SEEKSAQDGNNASPSHTASQPNAPQDPKSAQGSATWEGDKDM DNEEEE

EEPCVICHENLSPENLSVLPCAHKFHSQ CIRPWLMQQGTCPTCRLHVLQPEEFPGHPNGQLPKI
Transcript ENSMUST00000023327
Sequence
ATGGATTCTCTAGCAGAAGAATTTTTTGTAAG - UNI15421 - - UNI24384 - TGGAAATCCTGATGTGGAGGAACAGACCAAGGAAGAAACTG

AGATTATAGCAGAGAAACCAGTCACTCAGCTG GACAAACAGAAAATGGATATATCTGCTGATCCTGAGCCTGTTAACGCACTATTAGAAATAAAGAAGG

TATTAAATCCAATCAGTGCTCTTCCCAAAGGTGTGTTCCCTAACATTGAAAAGTTCATACAAGAAGATTTCTCTTTCCAGACTATGCAG AGGGAAGTTA

CAACTCATAGCCAGACTGGGGAAGAAATTGTTCCTGCTCTAACATTACATTTTTTGATAACACAACTGGAAATGGCACTTAGAAACATTCAAGCTTCTAA

TTATACT GCACAACAAATTAATGTTGGTTATTATTTGACATTACTATTTTTGTATGGAGTGGCACTCACTGAAAGAGCAAAGAAAGAG GACTGCATAG

AAGCTGAAAATAAATTTCTGGTGATGAAGATGGTGATCCAAGAAAGTGAGATTTGTGAAAACTTTATGTGTTTAGTTTATTTTGGACGTGGTTTACTTCG

ATGTGCTCAGAAGAG - UNI34407 - ATATAATGGAGCACTACTAGAATTTTACAAAAGCTTACAAGAAATAGGAGATACAGATGATAATTGGTTTG

AAGTAGATCCTACAGATGATGAAGATTTACCTACAACCTTCAAA - UNI34407 - GATAGTCTCAATAATTTTATCAAAACAACTGAAAGTAATATA

ATGAAAGAGACCATTTGCAGTTATCTTGATTGTGAGCGTTCTTGTGAAGCTGACATTTTAAAGAACACCAATTATAAG - UNI34407 - GGATTTTT

CCAGCTAATGTGCAGTAAAAGTTGCTGTATTTACTTCCATAAAATTTGTTGGAAAAAGTTCAAGAACTTAAAGTATCCAGGAGAAAGTGATCAG AGTTT

TAGTGGGCAAAAATGTTTGAAAGAAGGATGTCCAGGTGACATGGTCAGGATGCTACAATGTGATGTGCCTGGAATTGTCAAAATTTTG TTTGAAGTGGT

GAGAAAGGATGAATATATAACCATTGAAAACTTAGGAGCAAG - UNI19776 - TTACAAGAATTTGATGTCTCTGGAACTAACTGACACTGATATTA

GACCGAAATTCAATTTAAAACCAAACACAAAAG ATGAAGTGCCTATCTTCAAACTTGATTATAATTATTTCTATCATCTGCTTCATATAATTATTATTT

CTGGTACTGACATGGTCCGGCAAATATTTGATGAGGCTATGCCACCCACTCTTTTGAAAAAAGAGCTGCTTATACACAAGAATGTGCTGGAACCCTACTA

CAATCATCTTTGGACCAATCACCCTTTGGGTGGATCATGGCATCTGCTTTACCCCCCAAACAAGGAGCTACCACAGTCCAAACAGTTTGACTTATGCCTC

TTATTAGCGCTCATTAAACATCTGAATGTATTCCCTGCACCCAGAAAAGGCTGGGATATGGAACCACCATCTTCTGATCTCTCTAAGTCTGCAGACATTC

TGAGGCTCTGCAAGTACAGGGATATCCTTCTCAGTGAGATTCTGATGAATGGTCTCACCGAGTTACAGTTCAATTCAATTTGGAAAAAAGTTTCTGATAT

TCTTCTGCGCCTTGGGATGAAACAAGACGATATTGACAAAGTCAAGGAGAATCCCATTGAGAATATCTCCCTTGATTATCATCAGCTGTCCATTTATCTA

GGCATACCAGTACCAGAAATCATCCAGAGGATGTTATCCTGCTATCAACAAG GAATTACTCTACAGTCAATAACAGGCAGTCAGC - UNI5379 - G

TTTAGATGTAGAAGAGTTCCAGAATGATGAAGAAGACTTGAGTCCACCTGTGATGGAATATAATATCGATGTGAAATCAAACACTGAGATACAGTTAGCA

GAGATAAATAAAGATGTAGCCTCGATACCTAGTGAATCTTCAACAGAATCTGTTAAAGATCTTCAGGAG GTCAAAAGTAAAACAAAGAAGAAGAAAAGA

ACTAAGAGTAATAAAAAG - UNI2265 - GATAAGGATTCAGAAGATGAGCAAGT CTCATATATGGTAGAAAAGGACGACCAGCTGGAGACAGAACA

AGTAGACGTGAACACACTCAGTACATACATGAAAACTGATACAAGTGATGCACAAGAAGATTCTGCAGCTGAGGACAAGTTCTGTAGCCTGGATGAACTG

CATATTCTAGATATGGTAGAGCAG GGCTCATCTGGAAAGGAAAGTACAGACTTCAAAGAAACTGAAAAGGAAAGGCTTGCTCATCAACATCAGCTTTAT

AAATTGCAGTATGAATGTGAA GATTACAAAAGGCAACTGAAAACAGTGACATTTCGGTGGCAGGAAAATCAAATGCTGATCAAAAAGAAAGAAAAGATT

ATTGTATCTCTTAACCAACAAGTGGCTTTTGGGATCAATAAAATGTCCAA ATTACAGCGCCAAATCCATGCTAAAGATGATGAAATCAAGAACCTTAAA

GACCAACTTTCCTTGAAAAG ATCTCAGTGGGAAATGGAGAAGCATAATCTGGAAAGCACAGTTAAAACATATTTAAACAAACTAAATGCAGAAACCAGC

AGAGCCTTAACAGCCGAG GTGTACTTTTTACAGTGTCGTAGAGACTTTGGTTTACTACACCTCGAGCAGACAGAAAAAGAGTGCCTCAATCAGCTGGCC

AGGGTGACACACATGGCAGCAAG CAACCTAGAATCACTTCAACTAAAAGCTGCTGTAGATAGTTGGAATGCTATTGTGGCGGATGTTCGAAACAAGATT

GCATTCCTCAGG ACACAGTACAATGAACAGATCAACAAGGTTAAGCAGGGGTTTGCCTTGAGTACCTTGCCTCCAGTCCAGCTTCCTCCACCACCACCA

AGTCCTGAGATACTG - UNI8265 - ATACAGCAATTCTTAGGAAGACCCCTTGTGAAGGAATCTTTCTTTCGACCCATACTTACTGTCCCTCAAATG

CCTGCAGTTTGCCCTGGAGTCATCTCTGCAGCTGTACAACCTAGACCACCCCTG ATGCCTGGTATAACCTGGGCTATGCCAACACCTATAGGTGATACT

GTGTCACCGAGTGCAAGTCTGTGCAGTGAACCTCTCATGATAAACTGGGAGAGGATTACAGACAGGCTGAAAACTGCTTTTCCACAACAGACAAG GAAA

GAGCTAACAGATTTCTTACAACAGTTAAAGGATTCTCATGGAAAGTCCGTGTCTCGACTGACATTTGATGAAATTGTTTACAAAATTTCTCAAATGATTG

AGCCCAAGAAATCTGAG AGTGAAGAAAAGTCTGCTCAAGATGGCAATAATGCTTCACCCAGCCACACTGCATCACAGCCTAATGCTCCCCAGGACCCCA

AGTCAGCACAAGGTTCTGCCACATGGGAAGGAGACAAAGACATG GATAATGAAGAGGAAGAAGAGGAGCCTTGTGTAATCTGTCATGAGAATTTGTCTC

CAGAAAACCTTTCAGTTTTGCCTTGTGCTCACAAATTTCACTCTCAG TGCATTAGACCATGGTTGATGCAACAGGGCACATGCCCCACCTGCAGACTCC

ATGTTTTGCAACCAGAAGAATTCCCTGGCCACCCCAACGGGCAGTTACCCAAGATCTGA
Translation
MDSLAEEFFVS - UNI15421 - - UNI24384 - SGNPDVEEQTKEETEIIAEKPVTQL DKQKMDISADPEPVNALLEIKKVLNPISALPKGVFP

NIEKFIQEDFSFQTMQ REVTTHSQTGEEIVPALTLHFLITQLEMALRNIQASNYT AQQINVGYYLTLLFLYGVALTERAKKE DCIEAENKFLVMKMV

IQESEICENFMCLVYFGRGLLRCAQKR - UNI34407 - RYNGALLEFYKSLQEIGDTDDNWFEVDPTDDEDLPTTFK - UNI34407 - DSLNNF

IKTTESNIMKETICSYLDCERSCEADILKNTNYK - UNI34407 - GFFQLMCSKSCCIYFHKICWKKFKNLKYPGESDQ SFSGQKCLKEGCPGDMV

RMLQCDVPGIVKIL FEVVRKDEYITIENLGAS - UNI19776 - SYKNLMSLELTDTDIRPKFNLKPNTKD DEVPIFKLDYNYFYHLLHIIIISGT

DMVRQIFDEAMPPTLLKKELLIHKNVLEPYYNHLWTNHPLGGSWHLLYPPNKELPQSKQFDLCLLLALIKHLNVFPAPRKGWDMEPPSSDLSKSADILRL

CKYRDILLSEILMNGLTELQFNSIWKKVSDILLRLGMKQDDIDKVKENPIENISLDYHQLSIYLGIPVPEIIQRMLSCYQQG GITLQSITGSQR - UN

I5379 - RLDVEEFQNDEEDLSPPVMEYNIDVKSNTEIQLAEINKDVASIPSESSTESVKDLQE VKSKTKKKKRTKSNKK - UNI2265 - DKDSE

DEQV VSYMVEKDDQLETEQVDVNTLSTYMKTDTSDAQEDSAAEDKFCSLDELHILDMVEQ GSSGKESTDFKETEKERLAHQHQLYKLQYECE DYKRQ

LKTVTFRWQENQMLIKKKEKIIVSLNQQVAFGINKMSK KLQRQIHAKDDEIKNLKDQLSLKR RSQWEMEKHNLESTVKTYLNKLNAETSRALTAE VY

FLQCRRDFGLLHLEQTEKECLNQLARVTHMAAS SNLESLQLKAAVDSWNAIVADVRNKIAFLR TQYNEQINKVKQGFALSTLPPVQLPPPPPSPEIL 

- UNI8265 - IQQFLGRPLVKESFFRPILTVPQMPAVCPGVISAAVQPRPPL MPGITWAMPTPIGDTVSPSASLCSEPLMINWERITDRLKTAFPQQ

TR RKELTDFLQQLKDSHGKSVSRLTFDEIVYKISQMIEPKKSE SEEKSAQDGNNASPSHTASQPNAPQDPKSAQGSATWEGDKDM DNEEEEEEPCVI

CHENLSPENLSVLPCAHKFHSQ CIRPWLMQQGTCPTCRLHVLQPEEFPGHPNGQLPKI

For any suggestions or comments, please send an email to unitrap@crg.es