Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000064138 (1110033M05Rik)
Chromosomal location
Chr 13: 77847983 - 78305491 (+)
Description
RIKEN cDNA 1110033M05 gene Gene [Source:MGI Symbol;Acc:MGI:1915925]
UniGene
Mm.475497 Mm.343005 
MGI
MGI:1915925 
Uniprot/SWISSPROT
Q3TNH5 
Uniprot/SPTREMBL
Q3V345 Q6PFX1 Q9Z106 
Human Ortholog
ENSG00000113391 (FAM172A)
Omim not available
UniTrap UNI33927
Vector Insertion
Chr 13: 77848115 - 77898688
Public Clones (sanger) IST10616F10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2808
Vector Insertion
Chr 13: 77901200 - 77964583
Public Clones AG0505 (sanger) AG0492 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000070976
Sequence
CGAACTTGGTCGGGGCGCGGATCTTGAGAGAGAAAGTCCGAGCCAGGGCGCAAGGGAGTTCGCCCAGAGATCTGGAAGGCCACGCCTCCTCGCACCTACC

CTCTCAGCATTGCAGCTGGGGACAGAGCTCAG - UNI33927 - ATTTGCTGTCTAGGATCGATTTGGATGAACTCATGAAAAAGGACGAACCACCTT

TTGATTTTCCAGATACACTGGAAGGCTTTGAATATGCTTTTAATGAAA AGGGGCAGTTAAGACACATAAAAACTGGGGAACCATTTGTTTTTAACTACC

GAGAAGACTTACACAGGTGGAACCAGAAAAGATATGAAGCTCTGGGCGAG - UNI2808 - ATCATCACAAGATATGTTTATGAGCTCCTGGAAAGTG

ACTGTAATTTGAAAAAAATCTCTATTCCA GTAGATGCCACTGAGAGTGAACCAAAGAGTTTTATCTTTATGAGTGAGGATGCTTTGACAAATCCACAGA

AACTGATGGTTTTAATTCATGGTAGTGGTGTTGTCAGGGCAGGTCAGTGGGCTAGAAGGCTTATTATTAATGAAGATCTGGACAGTGGCACACAGATACC

TTTTATTAAGAGAGCTATGGAT GCGTTTCTGCTTGTGTGTGTAAAGGGGGAAAGTAAAGTAGATGGCCCTGCAATCCTTTAA
Translation
 - UNI33927 - MKKDEPPFDFPDTLEGFEYAFNEK KGQLRHIKTGEPFVFNYREDLHRWNQKRYEALGE - UNI2808 - IITRYVYELLESDC

NLKKISIP VDATESEPKSFIFMSEDALTNPQKLMVLIHGSGVVRAGQWARRLIINEDLDSGTQIPFIKRAMD AFLLVCVKGESKVDGPAIL
Transcript ENSMUST00000099358
Sequence
CGAACTTGGTCGGGGCGCGGATCTTGAGAGAGAAAGTCCGAGCCAGGGCGCAAGGGAGTTCGCCCAGAGATCTGGAAGGCCACGCCTCCTCGCACCTACC

CTCTCAGCATTGCAGCTGGGGACAGAGCTCAG - UNI33927 - ATTTGCTGTCTAGGATCGATTTGGATGAACTCATGAAAAAGGACGAACCACCTT

TTGATTTTCCAGATACACTGGAAGGCTTTGAATATGCTTTTAATGAAA AGGGGCAGTTAAGACACATAAAAACTGGGGAACCATTTGTTTTTAACTACC

GAGAAGACTTACACAGGTGGAACCAGAAAAGATATGAAGCTCTGGGCGAG - UNI2808 - ATCATCACAAGATATGTTTATGAGCTCCTGGAAAGTG

ACTGTAATTTGAAAAAAATCTCTATTCCA GAAGGGTATGGAGTCATCGTCCTGAACCCAAATGAAAACTATATAGAAGTGGAAAAGCAGAAAATGCATA

AACAGTCATCATCTTCTGATGGTACAGATGAGCCAGCAGGGAAGCGGGAAAGGAGAGATAAGGTCTCCAAGGAAACAAAGAAGCGTCGTGATTTCTATGA

GAAGTACCGCAACCCTCAAAAGGAGAAAGAAATGATGCAGTTGTTTATCAGG GAAAATGGTTCTCCTGAAGAGCATGCGGTCTATGTGTGGGACCATTT

CATAGCCCAGGCTGCTGCTGAGAATGTGTTCTTTGTGGCTCATAGCTATGGAGGACTTGCTTTTGTTGAACTG ATGATTCAACGAGAAGCAGATGTAAA

AAGTAAGGTGACTGCTGTGGCATTGACAGACTCTGTTCACAATGTGTGGCATCAAGAAGCTGGCAAAACCATCCGAGAATGGATGAGAGAG AACTGTTG

TAACTGGGTCTCCAGCTCAGAACCATTAGATACATCGGTGGAATCCATGCTGCCTGACTGTCCCAGAGTGTCTGCAG GCACCGACCGTCACGAGCTCAC

TTCCTGGAAGAGCTTCCCGTCTATCTTCAAGTTCTTCGCGGAAGCCTCGGAGGCCAAGAGCAGCTCGCAGAAGCCGGCCCTGACGCGGCGCTCGCACCGG

ATCAAGCACGAGGAGCTGTGAGCGCGCAGCCGCCCGCCCGCCGCCCGTAGCCTCCTGGCCCCCATTAGATTGCTTTCTTTCTCCAGCGCAGGGTCGTGAT

GTGTCCGTCTAAATAGCGTTTTGCATTATTTCTAGATGAGTGCAACTGTCAAAGCAATATGGCTTCAGCGGCCGAGTTGCCTGCGGCTGAGCCGGGCCTC

GCACTGTGGGCCCCGGCGACCGAGGCTGAAAGCGCCGGGAGTGCCAGCGCCGGGCGCTCCTAATTGCCCGGCTGATCCGCGGGCGCGGCTGGCCGAGCGG

CGTCTGCGCGGTCCTACCGCCCGCTGCAGCGCGGTCGCCGCTGCCCAGCCTCAATTGTGCCCATTTTTAATCCCCTTTAAACCCAGCAAGCTTTTATTCT

AAACCTCAAACTTGATTTTAACCAGGTTTTTTCCTCAGGTCATCTAATGAGCCTCTGTCTTTTACACAAAGCCACACACTCGAGTCCTAAAAATGCCAAC

TTTAAATTCAGAACATGATGGACTATGTAGTTTGGGGAGTACAAGTTCTTTCTCCCTATAACGACTTATTTTCACTTCAACCCCCCCCCCCAAAAAAAAA

AAAACTGTACATGAAGTACCGAATCCGAATCCTCATTTGTGCCCAGTTGAACTCCAGTCTTTATGTCTCTGATTTCAGGAGGGAATGTCGAAAGGAAAAT

ATAAACAGATCTTTTAGATGTAGGTATAAGTCTCCATGTTCAGTGAATTTTCCAGTTACTTATAAGAACTGACCTTACTATTAAAATATATAACACGATG

TGTGCGCCAATGCAGGGTGATGGTGGTGGCTGTTGATCCTTACAACCTGTACTTTCACCTTTCTTGTAGCGTGCCCTGTCAGATGCAGGACTTTTTTACT

ATCATCAAGAAAATAAAACTACATAACCTCTTTCTTCCAAAAGTCCAAGTAGGGTTAATGTGCTTCAGTTTTCATCTGCAGTAGGAAAAGAGAGGCGTAG

TGTGAATGGGTTGCTCTTTTGAGGCCAAAATGTTTACTGTTCTCTTCCTGTGATAGGGCGCTGCCCTGTAATTCCAACAGTAAGGCCAACGCGGAAGATA

AAATAAGTTGACATTTTACTGGCTTTTGAATTAAAGCATTAGACATTAATTACTTGAAATTTTTAATTAGTGAAGGTTATATCCAGTGCATGGTGAGATT

GTGATTTAATACATCCATCCTTTTTAAAATGAATGCAATAAGTAATTTGTCTACCTTGTTTGAGACCTTGAGACAGTATAAGCAAAATGAGTCTGAGTTG

CTAATGACAGGGAAGAAAACCTGAGCTCAGCCACCTCATGAGGAATACTCTCATCCCATGAACTGATTTTAGCAAGGTTTAAACTGGTAACATGTCATGC

TCTTTGCACATGCATACATTCAGTAATTCTGTAAGGACAGTAAAGTCCTCAGTGCCATGGCTGGGCATCTCCTGACATTACTTAGGCAGAAGTACCTTAG

GAAAAACCAAAATGGGGCTTTCTCCAGCTTTTGGGCAGTTTAAATATGTTACTCCAACAGTGTCAAGCACATTGAACTGTCATAGTGGCCCTTTACATTT

CTGCTTTTAGAAGGATTGGTGAACTCTGTGAAAATAATATCTTTCCAGTTACTGGGCTTGAAACACTGGTGTGCATTGATTATATTTTACCAAATGTTAT

AAATTGTCTGGTGTTTTCAGTATGTGAAAATGTTCACAAGAAAGTGAGTTTGCAACATGTAGAGGTTGGAAAAACCTATGCAGGGCTAAATTTGCTAGAC

TTCTGCAGCTAAATTAAAGCAGAGTTAAAGTGCTCAGCTTATGAACCAAACAAAAGTATCCTGCTCCTGCCCTCCGGGTTCCTCTCTGCAACTCTTAAAC

CTTATTCAGAGAAAGTCTCTGTTTCCTTGGGATGAGTACTTTACTGTCACTGGATTGTAACCTTGTCTTCTGTCTAGCAGAGAGCTATTTACAAAGTTAC

ATTTTGTAAATGTCTGTTACTACTTTTGAATCTGTGCTATAGCAACCCAGAGGGAGCCAGGCGCAGCACCCCAGATCACCAGCTGATGAGTGACAAATGA

TTCTTTACAATGTAGGATTTCTTGACCTGTTGATTGGGTTGCTGTTGGTATATGTGTAAGGATGTTATTCACCTCAGCTTTCTTGGGATAACAACAAGCA

CTTGGCAGTACCCTGCCTACAGGGAGGCCAGGGTTAATATTTCTCATCTGGCCTTCTCCCTATTTTTATTCTAGGCACACAGTGGTAGAAAGGTAAGGTG

TGAGCTTTTTTAAAAATAAATCTTATACTTAGTTCTTAAAGTAAATAGATGGAAAGAGACATAAATTGGAAATTCAAAATAGTCTGATTCAAGCTTTGGA

GCTTTTTCGGGTACCTAACACACAGTCCTTGGAAGTCATCATGGATGTTTGCTAGACCATCTACGTGTAATAATTGTTCTTTTCTCACAATTCTGCCTTG

TGCTTCCTGAAATGCATTTTTGTTTGTTTATATGTCAAAAATAATAAAGTGTGGACCTCCTATAATCTTGTTTACCATTTTAAAATAAAATTTTCC
Translation
 - UNI33927 - MKKDEPPFDFPDTLEGFEYAFNEK KGQLRHIKTGEPFVFNYREDLHRWNQKRYEALGE - UNI2808 - IITRYVYELLESDC

NLKKISIP EGYGVIVLNPNENYIEVEKQKMHKQSSSSDGTDEPAGKRERRDKVSKETKKRRDFYEKYRNPQKEKEMMQLFIR ENGSPEEHAVYVWDHF

IAQAAAENVFFVAHSYGGLAFVEL MIQREADVKSKVTAVALTDSVHNVWHQEAGKTIREWMRE NCCNWVSSSEPLDTSVESMLPDCPRVSAG GTDRH

ELTSWKSFPSIFKFFAEASEAKSSSQKPALTRRSHRIKHEEL
Transcript ENSMUST00000091459
Sequence
CGAACTTGGTCGGGGCGCGGATCTTGAGAGAGAAAGTCCGAGCCAGGGCGCAAGGGAGTTCGCCCAGAGATCTGGAAGGCCACGCCTCCTCGCACCTACC

CTCTCAGCATTGCAGCTGGGGACAGAGCTCAG - UNI33927 - ATTTGCTGTCTAGGATCGATTTGGATGAACTCATGAAAAAGGACGAACCACCTT

TTGATTTTCCAGATACACTGGAAGGCTTTGAATATGCTTTTAATGAAA AGGGGCAGTTAAGACACATAAAAACTGGGGAACCATTTGTTTTTAACTACC

GAGAAGACTTACACAGGTGGAACCAGAAAAGATATGAAGCTCTGGGCGAG - UNI2808 - ATCATCACAAGATATGTTTATGAGCTCCTGGAAAGTG

ACTGTAATTTGAAAAAAATCTCTATTCCA GTAGATGCCACTGAGAGTGAACCAAAGAGTTTTATCTTTATGAGTGAGGATGCTTTGACAAATCCACAGA

AACTGATGGTTTTAATTCATGGTAGTGGTGTTGTCAGGGCAGGTCAGTGGGCTAGAAGGCTTATTATTAATGAAGATCTGGACAGTGGCACACAGATACC

TTTTATTAAGAGAGCTATGGAT GAAGGGTATGGAGTCATCGTCCTGAACCCAAATGAAAACTATATAGAAGTGGAAAAGCAGAAAATGCATAAACAGTC

ATCATCTTCTGATGGTACAGATGAGCCAGCAGGGAAGCGGGAAAGGAGAGATAAGGTCTCCAAGGAAACAAAGAAGCGTCGTGATTTCTATGAGAAGTAC

CGCAACCCTCAAAAGGAGAAAGAAATGATGCAGTTGTTTATCAGG GAAAATGGTTCTCCTGAAGAGCATGCGGTCTATGTGTGGGACCATTTCATAGCC

CAGGCTGCTGCTGAGAATGTGTTCTTTGTGGCTCATAGCTATGGAGGACTTGCTTTTGTTGAACTG ATGATTCAACGAGAAGCAGATGTAAAAAGTAAG

GTGACTGCTGTGGCATTGACAGACTCTGTTCACAATGTGTGGCATCAAGAAGCTGGCAAAACCATCCGAGAATGGATGAGAGAG AACTGTTGTAACTGG

GTCTCCAGCTCAGAACCATTAGATACATCGGTGGAATCCATGCTGCCTGACTGTCCCAGAGTGTCTGCAG GCACCGACCGTCACGAGCTCACTTCCTGG

AAGAGCTTCCCGTCTATCTTCAAGTTCTTCGCGGAAGCCTCGGAGGCCAAGAGCAGCTCGCAGAAGCCGGCCCTGACGCGGCGCTCGCACCGGATCAAGC

ACGAGGAGCTGTGAGCGCGCAGCCGCCCGCCCGCCGCCCGTAGCCTCCTGGCCCCCATTAGATTGCTTTCTTTCTCCAGCGCAGGGTCGTGATGTGTCCG

TCTAAATAGCGTTTTGCATTATTTCTAGATGAGTGCAACTGTCAAAGCAATATGGCTTCAGCGGCCGAGTTGCCTGCGGCTGAGCCGGGCCTCGCACTGT

GGGCCCCGGCGACCGAGGCTGAAAGCGCCGGGAGTGCCAGCGCCGGGCGCTCCTAATTGCCCGGCTGATCCGCGGGCGCGGCTGGCCGAGCGGCGTCTGC

GCGGTCCTACCGCCCGCTGCAGCGCGGTCGCCGCTGCCCAGCCTCAATTGTGCCCATTTTTAATCCCCTTTAAACCCAGCAAGCTTTTATTCTAAACCTC

AAACTTGATTTTAACCAGGTTTTTTCCTCAGGTCATCTAATGAGCCTCTGTCTTTTACACAAAGCCACACACTCGAGTCCTAAAAATGCCAACTTTAAAT

TCAGAACATGATGGACTATGTAGTTTGGGGAGTACAAGTTCTTTCTCCCTATAACGACTTATTTTCACTTCAACCCCCCCCCCCAAAAAAAAAAAAACTG

TACATGAAGTACCGAATCCGAATCCTCATTTGTGCCCAGTTGAACTCCAGTCTTTATGTCTCTGATTTCAGGAGGGAATGTCGAAAGGAAAATATAAACA

GATCTTTTAGATGTAGGTATAAGTCTCCATGTTCAGTGAATTTTCCAGTTACTTATAAGAACTGACCTTACTATTAAAATATATAACACGATGTGTGCGC

CAATGCAGGGTGATGGTGGTGGCTGTTGATCCTTACAACCTGTACTTTCACCTTTCTTGTAGCGTGCCCTGTCAGATGCAGGACTTTTTTACTATCATCA

AGAAAATAAAACTACATAACCTCTTTCTTCCAAAAGTCCAAGTAGGGTTAATGTGCTTCAGTTTTCATCTGCAGTAGGAAAAGAGAGGCGTAGTGTGAAT

GGGTTGCTCTTTTGAGGCCAAAATGTTTACTGTTCTCTTCCTGTGATAGGGCGCTGCCCTGTAATTCCAACAGTAAGGCCAACGCGGAAGATAAAATAAG

TTGACATTTTACTGGCTTTTGAATTAAAGCATTAGACATTAATTACTTGAAATTTTTAATTAGTGAAGGTTATATCCAGTGCATGGTGAGATTGTGATTT

AATACATCCATCCTTTTTAAAATGAATGCAATAAGTAATTTGTCTACCTTGTTTGAGACCTTGAGACAGTATAAGCAAAATGAGTCTGAGTTGCTAATGA

CAGGGAAGAAAACCTGAGCTCAGCCACCTCATGAGGAATACTCTCATCCCATGAACTGATTTTAGCAAGGTTTAAACTGGTAACATGTCATGCTCTTTGC

ACATGCATACATTCAGTAATTCTGTAAGGACAGTAAAGTCCTCAGTGCCATGGCTGGGCATCTCCTGACATTACTTAGGCAGAAGTACCTTAGGAAAAAC

CAAAATGGGGCTTTCTCCAGCTTTTGGGCAGTTTAAATATGTTACTCCAACAGTGTCAAGCACATTGAACTGTCATAGTGGCCCTTTACATTTCTGCTTT

TAGAAGGATTGGTGAACTCTGTGAAAATAATATCTTTCCAGTTACTGGGCTTGAAACACTGGTGTGCATTGATTATATTTTACCAAATGTTATAAATTGT

CTGGTGTTTTCAGTATGTGAAAATGTTCACAAGAAAGTGAGTTTGCAACATGTAGAGGTTGGAAAAACCTATGCAGGGCTAAATTTGCTAGACTTCTGCA

GCTAAATTAAAGCAGAGTTAAAGTGCTCAGCTTATGAACCAAACAAAAGTATCCTGCTCCTGCCCTCCGGGTTCCTCTCTGCAACTCTTAAACCTTATTC

AGAGAAAGTCTCTGTTTCCTTGGGATGAGTACTTTACTGTCACTGGATTGTAACCTTGTCTTCTGTCTAGCAGAGAGCTATTTACAAAGTTACATTTTGT

AAATGTCTGTTACTACTTTTGAATCTGTGCTATAGCAACCCAGAGGGAGCCAGGCGCAGCACCCCAGATCACCAGCTGATGAGTGACAAATGATTCTTTA

CAATGTAGGATTTCTTGACCTGTTGATTGGGTTGCTGTTGGTATATGTGTAAGGATGTTATTCACCTCAGCTTTCTTGGGATAACAACAAGCACTTGGCA

GTACCCTGCCTACAGGGAGGCCAGGGTTAATATTTCTCATCTGGCCTTCTCCCTATTTTTATTCTAGGCACACAGTGGTAGAAAGGTAAGGTGTGAGCTT

TTTTAAAAATAAATCTTATACTTAGTTCTTAAAGTAAATAGATGGAAAGAGACATAAATTGGAAATTCAAAATAGTCTGATTCAAGCTTTGGAGCTTTTT

CGGGTACCTAACACACAGTCCTTGGAAGTCATCATGGATGTTTGCTAGACCATCTACGTGTAATAATTGTTCTTTTCTCACAATTCTGCCTTGTGCTTCC

TGAAATGCATTTTTGTTTGTTTATATGTCAAAAATAATAAAGTGTGGACCTCCTATAATCTTGTTTACCATTTTAAAATAAAATTTTCC
Translation
NLVGARILREKVRARAQGSSPRDLEGHASSHLPSQHCSWGQSSD - UNI33927 - DLLSRIDLDELMKKDEPPFDFPDTLEGFEYAFNEK KGQLRH

IKTGEPFVFNYREDLHRWNQKRYEALGE - UNI2808 - IITRYVYELLESDCNLKKISIP VDATESEPKSFIFMSEDALTNPQKLMVLIHGSGVVR

AGQWARRLIINEDLDSGTQIPFIKRAMD EGYGVIVLNPNENYIEVEKQKMHKQSSSSDGTDEPAGKRERRDKVSKETKKRRDFYEKYRNPQKEKEMMQL

FIR ENGSPEEHAVYVWDHFIAQAAAENVFFVAHSYGGLAFVEL MIQREADVKSKVTAVALTDSVHNVWHQEAGKTIREWMRE NCCNWVSSSEPLDTS

VESMLPDCPRVSAG GTDRHELTSWKSFPSIFKFFAEASEAKSSSQKPALTRRSHRIKHEEL

For any suggestions or comments, please send an email to unitrap@crg.es