Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000064210 (Ano6)
Chromosomal location
Chr 15: 95621274 - 95805180 (+)
Description
anoctamin 6 Gene [Source:MGI Symbol;Acc:MGI:2145890]
RefSeq_dna
NM_175344 
RefSeq_peptide
NP_780553.2 
UniGene
Mm.38087 Mm.452138 
MGI
MGI:2145890 
Uniprot/SWISSPROT
Q6P9J9 
Human Ortholog
ENSG00000177119 (ANO6)
Omim not available
UniTrap UNI20536
Vector Insertion
Chr 15: 95621488 - 95694655
Public Clones CMHD-GT_452H2-3 (cmhd) (cmhd) IST13289B10 (tigm) IST11506D1 (tigm)
Private Clones OST359440 (lexicon) OST60783 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3872
Vector Insertion
Chr 15: 95694739 - 95724843
Public Clones AW0382 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8309
Vector Insertion
Chr 15: 95773907 - 95778702
Public Clones RRF355 (baygenomics) IST13204B1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30612
Vector Insertion
Chr 15: 95796455 - 95798053
Public Clones IST12214G6 (tigm) IST12100F7 (tigm) IST12695D10BBF1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109239
Sequence
ATGGCTCTGATGGCTGAGAGCCTTTGCCAG GAGGAGGAGCGCATCCCATTTACCACCTGTGGGAAGTGCATCCGGGTCACGCTGTGTGCGAGCGCCGTC

TTCTTCTGG - UNI8309 - ATCCTGCTCATCATCGCCTCTGTGATCGGGATCATTGTCTACAGGCTGTCCGTGTTCATCGTATTTTCCACAACGCTC

CCCAAGAACCCCAACGGGACAGACCCGATCCAGAAGTACCTGACCCCACAGATGGCCACATCCATCACAGCCTCCATCATCAGCTTCATCATCATCATGA

TCCTCAACACGATCTACGAGAAGGTGGCCATCATGATCACCAACTTCG AGCTCCCAAGGACCCAGACGGATTATGAGAACAGCCTGACCATGAAGATGT

TCTTGTTCCAGTTTGTCAACTATTACTCCTCATGCTTCTACATCGCATTCTTCAAGGGCAAATTCGTGGGCTATCCCGGGGACCCAGTGTACTTGCTGGG

CAAATACAGAAGCGAAGAG TGTGACCCGGGGGGCTGCCTCCTTGAACTGACCACACAGCTGACGATCATCATGGGGGGAAAGGCAATCTGGAACAACAT

ACAAGAAGTCTTGCTCCC ATGGGTTATGAATCTAATTGGACGATATAAAAGAGTCTCGGGATCAGAAAAGATAACCCCACGATGGGAACAGGATTACCA

TCTGCAGCCCATGGGCAAGCTGGGATTGTTCTATGAGTATCTTGAAATGA TTATTCAGTTTGGGTTCGTCACTTTATTTGTGGCCTCTTTCCCACTGGC

TCCCCTGCTGGCTCTGGTGAACAATATTTTGGAAATAAGAGTGGACGCGTGGAAGCTCACAACCCAGTTTAGGCGCATGGTGCCCGAAAAAGCCCAGGAT

ATCGGCGCGTGGCAGCCCATCATGCAAGGAATAGCCATCCTGGCCGTGGTGACCAAC GCCATGATCATTGCTTTCACATCAGACATGATCCCCCGCCTG

GTGTATTATTGGTCTTTCTCTATCCCTCCCTACGGGGACCACACTTATTACACCATGGACGGCTACATCAACAACACTCTCTCTGTCTTCAACATCACGG

ACTTCAAGAACACAGACAAAGAAAACCCATACATTGGGCTTGGTAACTATACCTTGTGCAG - UNI30613 - GTACCGTGACTTCCGAAACCCACCT

GGGCACCCACAAGAGTATAAACACAACATCTACTATTGGCACGTGATTGCCGCCAAGCTGGCCTTCATCATTGTCATGGAG CACATCATCTACTCTGTG

AAGTTCTTCATTTCCTACGCAATTCCAGATGTGTCCAAAATCACGAAAAGCAAGATCAAGAGGGAGAAATACCTCACGCAGAAGTTGCTTCACGAGAGTC

ACCTCAAAGACCTGACCAAAAACATGGGGATCATCGCCGAGAGGATAGGAGGAACGGTTGACAACAGCGTGCGGCCAAAACTCGAATGAGCGGGAGCTTT

AGGCCTGGAGAAGCACTTTAAAGAGAATTAGCTGTCAGACGTGTGTGAAGCACTAGAGAGGATGGCATTGGAACTCCTAGGCAGGCGGAGTCTTGCCCAT

GCCCATTTCTGCCTGTGTCATCTTCCAGTTTCAGCAAGCAGTGTGGAAACTGGAGAACAGAAAACTGATCAGGCAGAGCCTAAAACCACCTACCTGGAGG

TCCTGAACATGCTCCCTCTTTTGATAAATTGGAATTTTAGTAACAGGAAAAAAAGCCCTGAGGTGTGCCCAAGTTCTCCCCGGGACTTCGCTTTTCTGAC

CTCACGTGTGCAGAGCTCCTTTTCTGTGCTTAATTTTGCATTTTGCCAAATCTATCCCAGACCTATTTTGTCCGGACAGCACCATCACCAAAGACCAGGC

AGACCTCAGCCTTAATCGCCTCTGTGTTATCAACAATAGCCAGCTCAGGATTGAGTTTGGATGCTGTGTTAGGTCCCAGGTAGGCTCAAGAGTTCACAGT

ATTTCAGTGTCTTACTGTACACTCCAAGGAAGGAGACTCCGCTGCGTATGAAACAGCTTCTGTATCATTTCAGCCTGTATTTCCACCTCCAAGAAATACT

CGTCTTAGATTGGCATGAAGATGGAGGGTATTGAATGAAGAAGCCTGTCCCTGTTACTCCACGGTGACATTTGCTCTCTAGCAATACTCCCAGCATGCTC

TGGGTCTGACCAATGTTGACTGGCTTTCAGATCTTAAGGGTATATAAGATGAAAAGGTAGCAGCCCTTGTTGATCTGAACGGTTAATTTATCTCTTCTTG

GTAGATGATAATCAAATGATTGTAACTGTCTCGTCCTCAGCATCATGGGCCGGGAAGCCCATCCACTTCATGAGAACGGACTTAGCAGATGCAGAAGGGT

GGCACTACCAATCACCAAGCGCCTTCTGCCTTGCTCGCTGAAAAAGGCTGGTGGCCTGACGACACTGGGCGTAGTCAGAGCAACAGCCAGCTACCCAATC

ACTAGCCATATCCTGTGATCCCTCTGTGGCAGATGTCACTCACTGGGAACCCTACTGACTTCTCTGCTTGCCACGGTGACCAGCTTCCTTGCCCAGCTCC

ATTCGTTGCCTGCTAACTCGTTTGTAATCACAGCTGGGCTGGAGACAAGTCTACCAAGATTGTTGCCCTTTGAGGAAGGAAACCCTGGGTTGAATTTGAG

CCCCAAGCCTCCTCTCAAGCCATCAGGGGGTTATGGGAAAGGCTGGTTTATCTGCTGGTGGCTTGCTGCGAAGCCTCAGCTTCCTAGTGCCTTGCCCTCC

CTGTTGCTTGGCTGAGCAGTCTCTCTGCAGCCTGTGCTCCGCTTCTCCTCCAGTCCATCTGGAGGAGACATGGCGATACCTCGCACCCTTGACTGATCAC

AGAGGTCAGTGCTGGGTGAAGAAGGGAGGACCTGCCTCACACTGTTTGGGGATCGGGCCGCTGCTGACTGGATGGGTGTGGAATGCCTCGGTGCCTAGGA

ACCAAGCCAAGGAAAGTGAGCGGTTTTAGAGACTGCCTTCTCAACACCCGTGGTATTAAATGCCCACCACGAATGATTTACTAGAGAATTGAGAATCAAC

ATGATTAATCAAAGCAGTGTTCTGGGCTTTTGAGTAGCCCAGGGGGTCAGTGTGGGAGTATTTCCCCTCCTCCCTTGTCCTGGGAGTCCAGAGCCCGCCA

TACAGTGTCTATCTGTGCTGAGATAAAAATGACTACCTTCCTCCCTGAGGGATGCTCTCATTGCACAGCTGAAACCAAGTGCCACTCCTTGCCCCTACCC

CCAGATTGCCCTGGAGTGCCCTGCTCCCTCTGTTACCTCTTTTCCAGAGCCTGTGCTCACTTCCTAAGGACAGGAAAGTACTCCCACTCCATACCATAGA

AAGAGGAAATTTTCCCTTCCTTTCTTTGTAGACACAAAGAAAAATGTCAAATAAAAAGTGCATTTCTTCATCTATATTCCCCAGCCAAGAACTCCCTTCA

CAAAGTAGAAAGTACCACTATGGACAGAAGAAGGAGG
Translation
MALMAESLCQ EEERIPFTTCGKCIRVTLCASAVFFW - UNI8309 - ILLIIASVIGIIVYRLSVFIVFSTTLPKNPNGTDPIQKYLTPQMATSITA

SIISFIIIMILNTIYEKVAIMITNFE ELPRTQTDYENSLTMKMFLFQFVNYYSSCFYIAFFKGKFVGYPGDPVYLLGKYRSEE CDPGGCLLELTTQLT

IIMGGKAIWNNIQEVLLP PWVMNLIGRYKRVSGSEKITPRWEQDYHLQPMGKLGLFYEYLEMI IIQFGFVTLFVASFPLAPLLALVNNILEIRVDAWK

LTTQFRRMVPEKAQDIGAWQPIMQGIAILAVVTN AMIIAFTSDMIPRLVYYWSFSIPPYGDHTYYTMDGYINNTLSVFNITDFKNTDKENPYIGLGNYT

LCR - UNI30613 - RYRDFRNPPGHPQEYKHNIYYWHVIAAKLAFIIVME HIIYSVKFFISYAIPDVSKITKSKIKREKYLTQKLLHESHLKDLTK

NMGIIAERIGGTVDNSVRPKLE
Transcript ENSMUST00000071874
Sequence
GCAGGCTGAGCAGCGCCTGCTGAAGCAGAGCGCGGGCGGAGCGCAGCGGGGCAGTGCCGAGAGGGCAGAGCGGAGCTTGCGGCCCGAGCCGAGCGGAGCC

GAGCGGAGCCGAGAGCAGCCGAGTGACGGTCTCCGGGAGACATGCAGATGATGACTAGGAAGGTCCTGCTGAACATGGAGCTGGAGGAGGACGACGATGA

GGATGGAGACATTG - UNI20536 - TGCTGGAAAACTTTGACCAGACAATTGTCTGCCCCACCTTTGGATCACTGGAGAATCAGCAGGACTTCAGGA

CTCCAGAGTTT - UNI3872 - GAAGAATTTAACGGGAAGCCCGACTCCCTCTTTTTCACCGATGGCCAGAGGCGAATCGACTTCATCCTCGTGTATG

AAGATGAGAGCAAAAAGGAGAACAATAAGAAAGGGACAAATGAGAAACAGAAG AGGAAAAGACAAGCATACGAATCTAACCTTATCTGCCATGGGCTGC

AGCTGGAAGCAACAAGATCT GTTTCTGATGACAAGCTTGTGTTCGTAAAAGTGCACGCGCCCTGGGAAGTGCTGTGCACCTATGCTGAGATCATGCACA

TCAAACTCCCGCTAAAGCCAAACGACCTGAAAACGCGCTCGCCCTTTGGCAACCTCAACTGGTTCACCAAGGTCCTCCGGGTGAACGAGAGTGTCATCAA

GCCAGAGCAGGAGTTCTTCACTGCCCCTTTTGAGAAGAGCCGGATGAATGATTTCTACATCCTCGATAGAGATTCCTTCTTCAACCCTGCCACCAGAAGC

CGCATT GTTTATTTCATCCTCTCTCGGGTCAAATACCAAGTGATGAACAACGTTAACAAATTTGGGATTAATAGACTGGTCAGCTCTGGAATCTACAAA

GCAGCGTTTCCTCTGCACGAC TGCAGATTCAACTATGAGTCGGAGGACATCAGTTGTCCTAGCGAGCGTTACCTCCTGTACAGAGAATGGGCTCACCCT

CGGAGTATATACAAGAAGCAGCCCTTGGATCTTATCAG GAAGTATTACGGCGAGAAGATTGGAATCTACTTTGCTTGGCTGGGCTATTACACGCAGATG

CTCCTTCTCGCAGCTGTGGTGGGCGTGGCCTGCTTCCTCTATGGATATCTTGATCAGGATAACTGCACTTGGAG CAAAGAGGTCTGTGATCCTGACATC

GGTGGCCAGATCCTGATGTGCCCCCAGTGTGACAGGCTGTGTCCGTTCTGGAGGCTGAATATCACCTGTGAATCTTCTAAG AAATTGTGCATCTTTGAC

AGTTTTGGAACCCTGATCTTCGCTGTATTTATGGGAGTGTGGG TTACATTGTTTTTGGAGTTTTGGAAGCGGCGCCAGGCAGAGCTCGAATATGAATGG

GACACCGTTGAGCTACAGCAAGAGGAACAGGCCCGGCCAGAGTATGAGGCCCAGTGCAATCACGTGGTGATAAACGAGATCACTCAG GAGGAGGAGCGC

ATCCCATTTACCACCTGTGGGAAGTGCATCCGGGTCACGCTGTGTGCGAGCGCCGTCTTCTTCTGG - UNI8309 - ATCCTGCTCATCATCGCCTCT

GTGATCGGGATCATTGTCTACAGGCTGTCCGTGTTCATCGTATTTTCCACAACGCTCCCCAAGAACCCCAACGGGACAGACCCGATCCAGAAGTACCTGA

CCCCACAGATGGCCACATCCATCACAGCCTCCATCATCAGCTTCATCATCATCATGATCCTCAACACGATCTACGAGAAGGTGGCCATCATGATCACCAA

CTTCG AGCTCCCAAGGACCCAGACGGATTATGAGAACAGCCTGACCATGAAGATGTTCTTGTTCCAGTTTGTCAACTATTACTCCTCATGCTTCTACAT

CGCATTCTTCAAGGGCAAATTCGTGGGCTATCCCGGGGACCCAGTGTACTTGCTGGGCAAATACAGAAGCGAAGAG TGTGACCCGGGGGGCTGCCTCCT

TGAACTGACCACACAGCTGACGATCATCATGGGGGGAAAGGCAATCTGGAACAACATACAAGAAGTCTTGCTCCC ATGGGTTATGAATCTAATTGGACG

ATATAAAAGAGTCTCGGGATCAGAAAAGATAACCCCACGATGGGAACAGGATTACCATCTGCAGCCCATGGGCAAGCTGGGATTGTTCTATGAGTATCTT

GAAATGA TTATTCAGTTTGGGTTCGTCACTTTATTTGTGGCCTCTTTCCCACTGGCTCCCCTGCTGGCTCTGGTGAACAATATTTTGGAAATAAGAGTG

GACGCGTGGAAGCTCACAACCCAGTTTAGGCGCATGGTGCCCGAAAAAGCCCAGGATATCGGCGCGTGGCAGCCCATCATGCAAGGAATAGCCATCCTGG

CCGTGGTGACCAAC GCCATGATCATTGCTTTCACATCAGACATGATCCCCCGCCTGGTGTATTATTGGTCTTTCTCTATCCCTCCCTACGGGGACCACA

CTTATTACACCATGGACGGCTACATCAACAACACTCTCTCTGTCTTCAACATCACGGACTTCAAGAACACAGACAAAGAAAACCCATACATTGGGCTTGG

TAACTATACCTTGTGCAG - UNI30613 - GTACCGTGACTTCCGAAACCCACCTGGGCACCCACAAGAGTATAAACACAACATCTACTATTGGCACG

TGATTGCCGCCAAGCTGGCCTTCATCATTGTCATGGAG CACATCATCTACTCTGTGAAGTTCTTCATTTCCTACGCAATTCCAGATGTGTCCAAAATCA

CGAAAAGCAAGATCAAGAGGGAGAAATACCTCACGCAGAAGTTGCTTCACGAGAGTCACCTCAAAGACCTGACCAAAAACATGGGGATCATCGCCGAGAG

GATAGGAGGAACGGTTGACAACAGCGTGCGGCCAAAACTCGAATGAGCGGGAGCTTTAGGCCTGGAGAAGCACTTTAAAGAGAATTAGCTGTCAGACGTG

TGTGAAGCACTAGAGAGGATGGCATTGGAACTCCTAGGCAGGCGGAGTCTTGCCCATGCCCATTTCTGCCTGTGTCATCTTCCAGTTTCAGCAAGCAGTG

TGGAAACTGGAGAACAGAAAACTGATCAGGCAGAGCCTAAAACCACCTACCTGGAGGTCCTGAACATGCTCCCTCTTTTGATAAATTGGAATTTTAGTAA

CAGGAAAAAAAGCCCTGAGGTGTGCCCAAGTTCTCCCCGGGACTTCGCTTTTCTGACCTCACGTGTGCAGAGCTCCTTTTCTGTGCTTAATTTTGCATTT

TGCCAAATCTATCCCAGACCTATTTTGTCCGGACAGCACCATCACCAAAGACCAGGCAGACCTCAGCCTTAATCGCCTCTGTGTTATCAACAATAGCCAG

CTCAGGATTGAGTTTGGATGCTGTGTTAGGTCCCAGGTAGGCTCAAGAGTTCACAGTATTTCAGTGTCTTACTGTACACTCCAAGGAAGGAGACTCCGCT

GCGTATGAAACAGCTTCTGTATCATTTCAGCCTGTATTTCCACCTCCAAGAAATACTCGTCTTAGATTGGCATGAAGATGGAGGGTATTGAATGAAGAAG

CCTGTCCCTGTTACTCCACGGTGACATTTGCTCTCTAGCAATACTCCCAGCATGCTCTGGGTCTGACCAATGTTGACTGGCTTTCAGATCTTAAGGGTAT

ATAAGATGAAAAGGTAGCAGCCCTTGTTGATCTGAACGGTTAATTTATCTCTTCTTGGTAGATGATAATCAAATGATTGTAACTGTCTCGTCCTCAGCAT

CATGGGCCGGGAAGCCCATCCACTTCATGAGAACGGACTTAGCAGATGCAGAAGGGTGGCACTACCAATCACCAAGCGCCTTCTGCCTTGCTCGCTGAAA

AAGGCTGGTGGCCTGACGACACTGGGCGTAGTCAGAGCAACAGCCAGCTACCCAATCACTAGCCATATCCTGTGATCCCTCTGTGGCAGATGTCACTCAC

TGGGAACCCTACTGACTTCTCTGCTTGCCACGGTGACCAGCTTCCTTGCCCAGCTCCATTCGTTGCCTGCTAACTCGTTTGTAATCACAGCTGGGCTGGA

GACAAGTCTACCAAGATTGTTGCCCTTTGAGGAAGGAAACCCTGGGTTGAATTTGAGCCCCAAGCCTCCTCTCAAGCCATCAGGGGGTTATGGGAAAGGC

TGGTTTATCTGCTGGTGGCTTGCTGCGAAGCCTCAGCTTCCTAGTGCCTTGCCCTCCCTGTTGCTTGGCTGAGCAGTCTCTCTGCAGCCTGTGCTCCGCT

TCTCCTCCAGTCCATCTGGAGGAGACATGGCGATACCTCGCACCCTTGACTGATCACAGAGGTCAGTGCTGGGTGAAGAAGGGAGGACCTGCCTCACACT

GTTTGGGGATCGGGCCGCTGCTGACTGGATGGGTGTGGAATGCCTCGGTGCCTAGGAACCAAGCCAAGGAAAGTGAGCGGTTTTAGAGACTGCCTTCTCA

ACACCCGTGGTATTAAATGCCCACCACGAATGATTTACTAGAGAATTGAGAATCAACATGATTAATCAAAGCAGTGTTCTGGGCTTTTGAGTAGCCCAGG

GGGTCAGTGTGGGAGTATTTCCCCTCCTCCCTTGTCCTGGGAGTCCAGAGCCCGCCATACAGTGTCTATCTGTGCTGAGATAAAAATGACTACCTTCCTC

CCTGAGGGATGCTCTCATTGCACAGCTGAAACCAAGTGCCACTCCTTGCCCCTACCCCCAGATTGCCCTGGAGTGCCCTGCTCCCTCTGTTACCTCTTTT

CCAGAGCCTGTGCTCACTTCCTAAGGACAGGAAAGTACTCCCACTCCATACCATAGAAAGAGGAAATTTTCCCTTCCTTTCTTTGTAGACACAAAGAAAA

ATGTCAAATAAAAAGTGCATTTCTTCATCTATATTCCCCAGCCAAGAACTCCCTTCACAAAGTAGAAAGTACCACTATGGACAGAAGAAGGAGG
Translation
MQMMTRKVLLNMELEEDDDEDGDIV - UNI20536 - VLENFDQTIVCPTFGSLENQQDFRTPEF - UNI3872 - EEFNGKPDSLFFTDGQRRID

FILVYEDESKKENNKKGTNEKQK RKRQAYESNLICHGLQLEATRS VSDDKLVFVKVHAPWEVLCTYAEIMHIKLPLKPNDLKTRSPFGNLNWFTKVLR

VNESVIKPEQEFFTAPFEKSRMNDFYILDRDSFFNPATRSRI VYFILSRVKYQVMNNVNKFGINRLVSSGIYKAAFPLHD CRFNYESEDISCPSERYL

LYREWAHPRSIYKKQPLDLIR RKYYGEKIGIYFAWLGYYTQMLLLAAVVGVACFLYGYLDQDNCTWS SKEVCDPDIGGQILMCPQCDRLCPFWRLNIT

CESSK KLCIFDSFGTLIFAVFMGVWV VTLFLEFWKRRQAELEYEWDTVELQQEEQARPEYEAQCNHVVINEITQ EEERIPFTTCGKCIRVTLCASAV

FFW - UNI8309 - ILLIIASVIGIIVYRLSVFIVFSTTLPKNPNGTDPIQKYLTPQMATSITASIISFIIIMILNTIYEKVAIMITNFE ELPRTQT

DYENSLTMKMFLFQFVNYYSSCFYIAFFKGKFVGYPGDPVYLLGKYRSEE CDPGGCLLELTTQLTIIMGGKAIWNNIQEVLLP PWVMNLIGRYKRVSG

SEKITPRWEQDYHLQPMGKLGLFYEYLEMI IIQFGFVTLFVASFPLAPLLALVNNILEIRVDAWKLTTQFRRMVPEKAQDIGAWQPIMQGIAILAVVTN

 AMIIAFTSDMIPRLVYYWSFSIPPYGDHTYYTMDGYINNTLSVFNITDFKNTDKENPYIGLGNYTLCR - UNI30613 - RYRDFRNPPGHPQEYKH

NIYYWHVIAAKLAFIIVME HIIYSVKFFISYAIPDVSKITKSKIKREKYLTQKLLHESHLKDLTKNMGIIAERIGGTVDNSVRPKLE

For any suggestions or comments, please send an email to unitrap@crg.es