Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000064280 (4930528G09Rik)
Chromosomal location
Chr 5: 20798779 - 20930495 (-)
Description
coiled-coil domain containing 146 Gene [Source:MGI Symbol;Acc:MGI:1922422]
Human Ortholog
not available
Omim not available
UniTrap UNI36833
Vector Insertion
Chr 5: 20838837 - 20905668
Public Clones IST14642D4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000030552
Sequence
GATACCAAGGACGCGACTCTTAGGAGAGGGTGAAGTTTTGAAGTGAGACCCCAGGGACCAAAACACACGGAGAAAAATAAGAGTTTAAACAAGGATCAGG

ACCAAAAGAAAGG - UNI36833 - AACTGTGAAAAATGGAATACAATAGCAAAGATGCAGAAGAAGAAACTGAAGATGAAGAGGAGGGACTGAAGGA

GGCGGAGGGGGAGGAACAGGAGAAGGAGGAGGTAACAGCAACCTCAGAAACAGACGATGACCAAGAAGACCTCCCTTCTGTCTTAGTGCCTACAGTTAAC

ATTCGGGAGGAGCGGCTCATCAATTTAGCTGAAACACCAGCTTTCCTCTGTCTGCATGAG - UNI36833 - CTGCACTCCAAGGGAAAACTTCCTGG

AACCAGAATGGCAGAGTTGAAAGCCAAGTACACCTTGCTACACGATACAGTGGTGAG - UNI36833 - CACGCAGGAGTCTGAGGTGCAGCTACTGG

AGAACGCCAAGCGCTTCACGGAGCAGATCCAGCAGCAGCAGGTCTGTCTGCAGCAGGCCGAAGACTTCCCCAACGTCTTCACCACTGAGGTCTGCAAACT

TCGGGAGCAGCTGCTCAAGTACCAAAATGAATACACGGCAGCGCAAGAAAGGGAGTACAATATTCAGTACAGGCTGACTAG CTTAACAGAAGAAAAGAG

TATCATATTAAAGGAATTTGAGAAGATACCTAAGCCAGGA GAAATAGAGAAGAAGACGAGGCTCCTGAAAGAAAGCACTGAGGAACTGCGCAAGGAGGT

GATTCAGAGGAGACTGGAGATCAAAAACCTGCGGGAAGATGTGGTGCTCAAGCAGAAGCAGCTAGTGAGGGAGCAGAAGGAGCTGGAGGAGCTGATGGAG

TATCAGGTTGGCTTGAAG GATGACGTGGTCCACCATCAAAGTGTTCCTGTACAAATTACAAAGGAGATAGAAAAAATGACACGCAAAAAAGT AGAAAC

AGAGAAGAAAAATATTGTCTTGGAATCTGAGTTGAAAGAGCTAAGTGACTCTTTAAAGAAGCTTGAAAACAAAGTCAACACTCTTGCGGAAGAAAGGGAT

GACATAATGAAGGAAGTTGAGGGCAAGCGAACCTTACTAGAAGTCAAAGAACGAGAGTATGGCCAACTGCTTAAACTATTGGAACTAACCAAAGAGAACG

AAGCCTCCTCGCTAGCTGAAAGGTTGCTTATATTTCTGCACATTCTGTCATTTAAATTTTAATCAATGATGTCCTGAAGATTCAAAATATTACCAATTGA

TTGTATGCTGTTTCAATAACAAGTTGTAGAATTATAAGTCAATTTTTAACCATTAATTAAATGTACCATCAAAGCA
Translation
 - UNI36833 - MEYNSKDAEEETEDEEEGLKEAEGEEQEKEEVTATSETDDDQEDLPSVLVPTVNIREERLINLAETPAFLCLHE - UNI36833 

- LHSKGKLPGTRMAELKAKYTLLHDTVVS - UNI36833 - STQESEVQLLENAKRFTEQIQQQQVCLQQAEDFPNVFTTEVCKLREQLLKYQNEYT

AAQEREYNIQYRLTS SLTEEKSIILKEFEKIPKPG EIEKKTRLLKESTEELRKEVIQRRLEIKNLREDVVLKQKQLVREQKELEELMEYQVGLK DDV

VHHQSVPVQITKEIEKMTRKKV VETEKKNIVLESELKELSDSLKKLENKVNTLAEERDDIMKEVEGKRTLLEVKEREYGQLLKLLELTKENEASSLAER

LLIFLHILSFKF
Transcript ENSMUST00000035915
Sequence
GATACCAAGGACGCGACTCTTAGGAGAGGGTGAAGTTTTGAAGTGAGACCCCAGGGACCAAAACACACGGAGAAAAATAAGAGTTTAAACAAGGATCAGG

ACCAAAAGAAAGG - UNI36833 - AACTGTGAAAAATGGAATACAATAGCAAAGATGCAGAAGAAGAAACTGAAGATGAAGAGGAGGGACTGAAGGA

GGCGGAGGGGGAGGAACAGGAGAAGGAGGAGGTAACAGCAACCTCAGAAACAGACGATGACCAAGAAGACCTCCCTTCTGTCTTAGTGCCTACAGTTAAC

ATTCGGGAGGAGCGGCTCATCAATTTAGCTGAAACACCAGCTTTCCTCTGTCTGCATGAG - UNI36833 - CTGCACTCCAAGGGAAAACTTCCTGG

AACCAGAATGGCAGAGTTGAAAGCCAAGTACACCTTGCTACACGATACAGTGGTGAG - UNI36833 - CACGCAGGAGTCTGAGGTGCAGCTACTGG

AGAACGCCAAGCGCTTCACGGAGCAGATCCAGCAGCAGCAGGTCTGTCTGCAGCAGGCCGAAGACTTCCCCAACGTCTTCACCACTGAGGTCTGCAAACT

TCGGGAGCAGCTGCTCAAGTACCAAAATGAATACACGGCAGCGCAAGAAAGGGAGTACAATATTCAGTACAGGCTGACTAG CTTAACAGAAGAAAAGAG

TATCATATTAAAGGAATTTGAGAAGATACCTAAGCCAGGA GAAATAGAGAAGAAGACGAGGCTCCTGAAAGAAAGCACTGAGGAACTGCGCAAGGAGGT

GATTCAGAGGAGACTGGAGATCAAAAACCTGCGGGAAGATGTGGTGCTCAAGCAGAAGCAGCTAGTGAGGGAGCAGAAGGAGCTGGAGGAGCTGATGGAG

TATCAGGTTGGCTTGAAG GATGACGTGGTCCACCATCAAAGTGTTCCTGTACAAATTACAAAGGAGATAGAAAAAATGACACGCAAAAAAGT AGAAAC

AGAGAAGAAAAATATTGTCTTGGAATCTGAGTTGAAAGAGCTAAGTGACTCTTTAAAGAAGCTTGAAAACAAAGTCAACACTCTTGCGGAAGAAAGGGAT

GACATAATGAAGGAAGTTGAGGGCAAGCGAACCTTACTAGAAGTCAAAGAACGAGAGTATGGCCAACTGCTTAAACTATTGGAACTAACCAAAGAGAACG

AAGCCTCCTCGCTAGCTGAAAG AGGGATCTTGGATATCAATCTACGGAACTGTCTCATCGACAAGCAGAACTACCATGATGAACTTTCTCGTAAGCAAA

GAGAGAAAGAACGAGATTTTCGGAATCTGAAGAAGACAGAGCTGCTCCTGAAAGTGTCTTTGGATGCGCTCACTCAGGCACAAGCCATGAATCAAAGGCT

TCTACTAGAG ATGGAAGCTATCCCAAAAGAATACCTTACATTGCCTGAACGAAGGAAAGAGCTCCACAAAGAGGTTGATCTAGCTAGGAGAAATCTGGC

TCAACAG AAATCTCTGTCAGAAGCTGAGGCCAAGTTAGTGGAGCAGCAGATTGCACAGGAGAACAAACTTCTAAAGGAGCAAGAAAGTTTGCGGGAGCT

GGTGTTCAACCTCGGGCGAATGACTCAGATCAAAATAGATGAGAAAGAACAAAAGGCTAAGGATTTCCTGAAAGCCCAG CGAAGATATAGTGAGATTGT

TAAGGAAATCAAATCAAAGGACCTTGAAATCAGGCTATACAAGAAGAGAAAGCATGAAATTCATAGGAG ACTCAGAGAATTTGCCAGCTTGTATGATAC

AATTAGAAATGAAAGAAACAAATTTGTAAACCTACTTCACAAAGCTCATCAGAAAGTAAATGAGATAAAAGAAAGACTCAAAATGTCATTAAATGAGCTG

GAAATCTTAAGGAACAGCGCTGTCTCTCAAGAACG AAAGCTACAAAACGCCATGCTAAAGCATTCCAACAATGTGACCATCAAGGAGAGCATACAGAAC

GATGTGTGCAAAATCACTGCTAAACTCCAGGAAATGAAGGAGAAGAAGGAGGCCCAGCTGACCAGCATGGACAGGCTGGCCAGCATGATCACCGTGATCG

AAGAGGAGATGGTGCAGCTGCGCAAGAAGTATGAGAAGGCCGTACAGCGGCGGAATGAAAG TGGTGTTCAGCTGATCGAGCGGGAAGAAGAAGTGTGCA

TTTTTTACGAAAAAGTGAATGTCCAAGAGAAGATAAAACTTCATCAGGATGTTGAAATCCACATTCTGGAAGAAAAAATCCGATTCCTAAAACTGAGGAT

TGCCGAAAAGCAAAGGCAGATTTCTGTGACACGGAAACTAGTGCCAATCAAGAAGTCCCTGGATGCCGACCTGGCTGTGATCCAGATTCAG TTTTCACA

GTGCACAGACAGGATAAAAGACCTGGAGAAACTCTTTGTGAACCCTGACAGCAAGGGCAGGGTCCGCTTCATTAAAGGGAAAGATCTGACTGAAGAAGAA

ATGATCAAGAAATTAGATATG CTGGAACTTCAGATAGCCAAGAAGGAGGAGAAGCTCCTGGAGAAGGATTTCATCTATGAGCAGGTGTCCCAGCTCACA

AACAGGCTCAAAGGCAAAACTCAGGCTTGCAAGAAGGACACACTGCTCTTAGCCAAGAAG ATGAATAGCTACCAACAAAAGATCAAAGTTGTTACCCAG

GAAATGATGGCTCTTGTTGCTGAGCTGTCCATGAAACAAGCCCTGACCATTGAACTCCAAAAGGAGGTGAGAGAGAAAGAAGAATTCATCTTCTCCTGCA

GTGCCAGGATAGAAAAGGGCCTCCCGCTCAACAGAGAGATTGAGAAGGACTGGCTGAAGGTGCTTCGAGATGAAGAAATGTATGCCTTTGCGACTGCTGA

GATGTCTCGG GAGTACATGGAAACGGATTATCGGCAGCTGCCCAATGGTGTTTATACAACTGCAGAGCAGCGTCCAAACGCCTACATGCCTGAAGCAGA

TACCGAGCTTCCTCTGCCCAAACCGTATGGCGCGATGGCTCCATTTAAGCCCTCTGAACCCGGAGCCAACAGGAGGCACATTAGGAAACCTGTTGTAAAG

CCCATTGAAATC
Translation
 - UNI36833 - MEYNSKDAEEETEDEEEGLKEAEGEEQEKEEVTATSETDDDQEDLPSVLVPTVNIREERLINLAETPAFLCLHE - UNI36833 

- LHSKGKLPGTRMAELKAKYTLLHDTVVS - UNI36833 - STQESEVQLLENAKRFTEQIQQQQVCLQQAEDFPNVFTTEVCKLREQLLKYQNEYT

AAQEREYNIQYRLTS SLTEEKSIILKEFEKIPKPG EIEKKTRLLKESTEELRKEVIQRRLEIKNLREDVVLKQKQLVREQKELEELMEYQVGLK DDV

VHHQSVPVQITKEIEKMTRKKV VETEKKNIVLESELKELSDSLKKLENKVNTLAEERDDIMKEVEGKRTLLEVKEREYGQLLKLLELTKENEASSLAER

 RGILDINLRNCLIDKQNYHDELSRKQREKERDFRNLKKTELLLKVSLDALTQAQAMNQRLLLE MEAIPKEYLTLPERRKELHKEVDLARRNLAQQ KS

LSEAEAKLVEQQIAQENKLLKEQESLRELVFNLGRMTQIKIDEKEQKAKDFLKAQ RRYSEIVKEIKSKDLEIRLYKKRKHEIHRR RLREFASLYDTIR

NERNKFVNLLHKAHQKVNEIKERLKMSLNELEILRNSAVSQER RKLQNAMLKHSNNVTIKESIQNDVCKITAKLQEMKEKKEAQLTSMDRLASMITVIE

EEMVQLRKKYEKAVQRRNES SGVQLIEREEEVCIFYEKVNVQEKIKLHQDVEIHILEEKIRFLKLRIAEKQRQISVTRKLVPIKKSLDADLAVIQIQ F

SQCTDRIKDLEKLFVNPDSKGRVRFIKGKDLTEEEMIKKLDM LELQIAKKEEKLLEKDFIYEQVSQLTNRLKGKTQACKKDTLLLAKK MNSYQQKIKV

VTQEMMALVAELSMKQALTIELQKEVREKEEFIFSCSARIEKGLPLNREIEKDWLKVLRDEEMYAFATAEMSR EYMETDYRQLPNGVYTTAEQRPNAYM

PEADTELPLPKPYGAMAPFKPSEPGANRRHIRKPVVKPIEI
Transcript ENSMUST00000115245
Sequence
GATACCAAGGACGCGACTCTTAGGAGAGGGTGAAGTTTTGAAGTGAGACCCCAGGGACCAAAACACACGGAGAAAAATAAGAGTTTAAACAAGGATCAGG

ACCAAAAGAAAGG - UNI36833 - AACTGTGAAAAATGGAATACAATAGCAAAGATGCAGAAGAAGAAACTGAAGATGAAGAGGAGGGACTGAAGGA

GGCGGAGGGGGAGGAACAGGAGAAGGAGGAGGTAACAGCAACCTCAGAAACAGACGATGACCAAGAAGACCTCCCTTCTGTCTTAGTGCCTACAGTTAAC

ATTCGGGAGGAGCGGCTCATCAATTTAGCTGAAACACCAGCTTTCCTCTGTCTGCATGAG - UNI36833 - CTGCACTCCAAGGGAAAACTTCCTGG

AACCAGAATGGCAGAGTTGAAAGCCAAGTACACCTTGCTACACGATACAGTGGTGAG - UNI36833 - CACGCAGGAGTCTGAGGTGCAGCTACTGG

AGAACGCCAAGCGCTTCACGGAGCAGATCCAGCAGCAGCAGGTCTGTCTGCAGCAGGCCGAAGACTTCCCCAACGTCTTCACCACTGAGGTCTGCAAACT

TCGGGAGCAGCTGCTCAAGTACCAAAATGAATACACGGCAGCGCAAGAAAGGGAGTACAATATTCAGTACAGGCTGACTAG CTTAACAGAAGAAAAGAG

TATCATATTAAAGGAATTTGAGAAGATACCTAAGCCAGGA GAAATAGAGAAGAAGACGAGGCTCCTGAAAGAAAGCACTGAGGAACTGCGCAAGGAGGT

GATTCAGAGGAGACTGGAGATCAAAAACCTGCGGGAAGATGTGGTGCTCAAGCAGAAGCAGCTAGTGAGGGAGCAGAAGGAGCTGGAGGAGCTGATGGAG

TATCAGGTTGGCTTGAAG GATGACGTGGTCCACCATCAAAGTGTTCCTGTACAAATTACAAAGGAGATAGAAAAAATGACACGCAAAAAAGT AGAAAC

AGAGAAGAAAAATATTGTCTTGGAATCTGAGTTGAAAGAGCTAAGTGACTCTTTAAAGAAGCTTGAAAACAAAGTCAACACTCTTGCGGAAGAAAGGGAT

GACATAATGAAGGAAGTTGAGGGCAAGCGAACCTTACTAGAAGTCAAAGAACGAGAGTATGGCCAACTGCTTAAACTATTGGAACTAACCAAAGAGAACG

AAGCCTCCTCGCTAGCTGAAAG AGGGATCTTGGATATCAATCTACGGAACTGTCTCATCGACAAGCAGAACTACCATGATGAACTTTCTCGTAAGCAAA

GAGAGAAAGAACGAGATTTTCGGAATCTGAAGAAGACAGAGCTGCTCCTGAAAGTGTCTTTGGATGCGCTCACTCAGGCACAAGCCATGAATCAAAGGCT

TCTACTAGAG ATGGAAGCTATCCCAAAAGAATACCTTACATTGCCTGAACGAAGGAAAGAGCTCCACAAAGAGGTTGATCTAGCTAGGAGAAATCTGGC

TCAACAG AAATCTCTGTCAGAAGCTGAGGCCAAGTTAGTGGAGCAGCAGATTGCACAGGAGAACAAACTTCTAAAGGAGCAAGAAAGTTTGCGGGAGCT

GGTGTTCAACCTCGGGCGAATGACTCAGATCAAAATAGATGAGAAAGAACAAAAGGCTAAGGATTTCCTGAAAGCCCAG CGAAGATATAGTGAGATTGT

TAAGGAAATCAAATCAAAGGACCTTGAAATCAGGCTATACAAGAAGAGAAAGCATGAAATTCATAGGAG ACTCAGAGAATTTGCCAGCTTGTATGATAC

AATTAGAAATGAAAGAAACAAATTTGTAAACCTACTTCACAAAGCTCATCAGAAAGTAAATGAGATAAAAGAAAGACTCAAAATGTCATTAAATGAGCTG

GAAATCTTAAGGAACAGCGCTGTCTCTCAAGAACG AAAGCTACAAAACGCCATGCTAAAGCATTCCAACAATGTGACCATCAAGGAGAGCATACAGAAC

GATGTGTGCAAAATCACTGCTAAACTCCAGGAAATGAAGGAGAAGAAGGAGGCCCAGCTGACCAGCATGGACAGGCTGGCCAGCATGATCACCGTGATCG

AAGAGGAGATGGTGCAGCTGCGCAAGAAGTATGAGAAGGCCGTACAGCGGCGGAATGAAAG TGGTGTTCAGCTGATCGAGCGGGAAGAAGAAGTGTGCA

TTTTTTACGAAAAAGTGAATGTCCAAGAGAAGATAAAACTTCATCAGGATGTTGAAATCCACATTCTGGAAGAAAAAATCCGATTCCTAAAACTGAGGAT

TGCCGAAAAGCAAAGGCAGATTTCTGTGACACGGAAACTAGTGCCAATCAAGAAGTCCCTGGATGCCGACCTGGCTGTGATCCAGATTCAG TTTTCACA

GTGCACAGACAGGATAAAAGACCTGGAGAAACTCTTTGTGAACCCTGACAGCAAGGGCAGGGTCCGCTTCATTAAAGGGAAAGATCTGACTGAAGAAGAA

ATGATCAAGAAATTAGATATG CTGGAACTTCAGATAGCCAAGAAGGAGGAGAAGCTCCTGGAGAAGGATTTCATCTATGAGCAGGTGTCCCAGCTCACA

AACAGGCTCAAAGGCAAAACTCAGGCTTGCAAGAAGGACACACTGCTCTTAGCCAAGAAG ATGAATAGCTACCAACAAAAGATCAAAGTTGTTACCCAG

GAAATGATGGCTCTTGTTGCTGAGCTGTCCATGAAACAAGCCCTGACCATTGAACTCCAAAAGGAGGTGAGAGAGAAAGAAGAATTCATCTTCTCCTGCA

GTGCCAGGATAGAAAAGGGCCTCCCGCTCAACAGAGAGATTGAGAAGGACTGGCTGAAGGTGCTTCGAGATGAAGAAATGTATGCCTTTGCGACTGCTGA

GATGTCTCGG GAGTACATGGAAACGGATTATCGGCAGCTGCCCAATGGTGTTTATACAACTGCAGAGCAGCGTCCAAACGCCTACATGCCTGAAGCAGA

TACCGAGCTTCCTCTGCCCAAACCGTATGGCGCGATGGCTCCATTTAAGCCCTCTGAACCCGGAGCCAACAGGAGGCACATTAGGAAACCTGTTGTAAAG

CCCATTGAAATCTAAACATGTGAACCAACCCAGCAGTCCTCTCACAGAGAGGGCCTGAGCCAAGCCTCAGACCTTCTATGGAGAATGAGCACCAGGGTTC

TAGGGCTGCTGATGAGCCAGGCACGGTCAACAACAATGGGTTGTTTCCAAAGCAGTGGCTTCCTTGTACATTCACCAACTATTACCTGGTAAGTGACACT

GAATGGGACATAGACTACAGCTGTGTCAAAGGGCATTTTGATTGTTCATGTGTTTCTTTTTCACTGCTTATAGTTACTACACCTCAGGAATGTACAGTAG

ACAAGATGCTGTAAAAGTACAAAATAAATAACTTTTCAGTGAAGTA
Translation
 - UNI36833 - MEYNSKDAEEETEDEEEGLKEAEGEEQEKEEVTATSETDDDQEDLPSVLVPTVNIREERLINLAETPAFLCLHE - UNI36833 

- LHSKGKLPGTRMAELKAKYTLLHDTVVS - UNI36833 - STQESEVQLLENAKRFTEQIQQQQVCLQQAEDFPNVFTTEVCKLREQLLKYQNEYT

AAQEREYNIQYRLTS SLTEEKSIILKEFEKIPKPG EIEKKTRLLKESTEELRKEVIQRRLEIKNLREDVVLKQKQLVREQKELEELMEYQVGLK DDV

VHHQSVPVQITKEIEKMTRKKV VETEKKNIVLESELKELSDSLKKLENKVNTLAEERDDIMKEVEGKRTLLEVKEREYGQLLKLLELTKENEASSLAER

 RGILDINLRNCLIDKQNYHDELSRKQREKERDFRNLKKTELLLKVSLDALTQAQAMNQRLLLE MEAIPKEYLTLPERRKELHKEVDLARRNLAQQ KS

LSEAEAKLVEQQIAQENKLLKEQESLRELVFNLGRMTQIKIDEKEQKAKDFLKAQ RRYSEIVKEIKSKDLEIRLYKKRKHEIHRR RLREFASLYDTIR

NERNKFVNLLHKAHQKVNEIKERLKMSLNELEILRNSAVSQER RKLQNAMLKHSNNVTIKESIQNDVCKITAKLQEMKEKKEAQLTSMDRLASMITVIE

EEMVQLRKKYEKAVQRRNES SGVQLIEREEEVCIFYEKVNVQEKIKLHQDVEIHILEEKIRFLKLRIAEKQRQISVTRKLVPIKKSLDADLAVIQIQ F

SQCTDRIKDLEKLFVNPDSKGRVRFIKGKDLTEEEMIKKLDM LELQIAKKEEKLLEKDFIYEQVSQLTNRLKGKTQACKKDTLLLAKK MNSYQQKIKV

VTQEMMALVAELSMKQALTIELQKEVREKEEFIFSCSARIEKGLPLNREIEKDWLKVLRDEEMYAFATAEMSR EYMETDYRQLPNGVYTTAEQRPNAYM

PEADTELPLPKPYGAMAPFKPSEPGANRRHIRKPVVKPIEI

For any suggestions or comments, please send an email to unitrap@crg.es