Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000066026 (Dhrs3)
Chromosomal location
Chr 4: 144482730 - 144517545 (+)
Description
dehydrogenase/reductase (SDR family) member 3 Gene [Source:MGI (curated);Acc:Dhrs3-002]
Human Ortholog
not available
Omim not available
UniTrap UNI35136
Vector Insertion
Chr 4: 144483613 - 144508553
Public Clones IST11218H3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000084184
Sequence
AACGGCTGTTGGGGCAAGAAACTTCTTGTTAAAACTTCCCACCCCTTGGACTCTCCACAGCCCCTCTCACCGTCCCAATCTTCTGAGACGCTTTTTACCT

CTCCGCCAGAGCAGAGTTTATCTTTTTTTTCTTTTTCTTTTTTTTTTCTTTTTCCTCCCATTTTTCCTCGCCCTGTCCTTTACATCTGAAAGGAGATCAG

TTCAAGAGTGACCAGGTGGGACGCCTCCTTTTCCTTATTTAGTTTATTATTGTTTGGGGGAGTTTTCTTTCTATCTTTTTTTAATTCCTGTCCGGGGAGT

TTTGTCCACCGCCTCCTACCACCTCCCCCTGTACCCCGCTCCTCCGCGCGGAGGATGGTGTGGAAATGGCTGGGCGCGCTGGTAGTGTTCCCTCTGCAAA

TGATCTATTTGGTAACCAAAGCAGCCGTGGGAATGGTGTTGCCCCCCAAGCTTCGGGACTTGTCGCGGGAGTCAGTCCTCATCACCGGCGGTGGGAGAGG

CATCGGACGCCACCTCGCTCGGGAGTTCGCAGAGCGTGGCGCCAGAAAG - UNI35136 - ATTGTTCTCTGGGGGCGGACTGAAAAATGCCTCAAGG

AGACGACAGAGGAGATTCGGCAGATGGGCACAGAGTGCCACTACTTCATCTGTGACGTGGGCAACCGGGAAGAGGTGTACCAGATGGCCAAAGCTGTCCG

AGAGAAG GTGGGTGACATCACCATCCTGGTGAACAATGCCGCTGTGGTCCATGGAAAAAGCTTGATGGACAGTGACGATGATGCCCTCCTCAAGTCCCA

GCATGTCAACACCCTGGGCCAATTCTGG ACCACCAAGGCCTTTTTGCCACGTATGCTGGAACTCCAGAACGGCCATATTGTGTGCCTCAATTCCGTGCT

TGCACTGTCAGCCATCCCTGGCGCCATCGACTACTGCACGTCAAAAGCATCAGCCTTCGCCTTCATGGAGAGCCTGACCTTGGGGCTGTTGGACTGTCCT

GGTGTCAGCGCCACCACCGTTCTGCCCTTTCACACCAGCACCGAGATGTTCCAGGGCATGAGAGTCAG GTTTCCCAACCTCTTCCCGCCACTGAAGCCA

GAGACAGTAGCCCGGAGGACGGTAGATGCTGTGCAACAAAACCAGGCCCTTCTCTTGCTCCCGTGGACCATGAATATCCTCATTATCTTGAAAAG CATA

CTCCCACAAGCTGCACTGGAGGAGATTCACAGGTTCTCGGGGACTTACACCTGTATGAACACCTTTAAGGGGAGGACATAGAGGCAGGAGGAAGACACAC

CTGAGGAGCTATGGAGCCTGAGGGGGAGCCACAGCAGCCGGGCACACAATCCTGTGCCTGTGCATTAGCACATCTGCTGGGTGAACAGGACTGTTCTTGT

CCCCAGGGAAGATTTTGCAGCTCCCCAGGTCAACTCCAGGACCTTTGTGCAAGACTGATGGGTTTAACTCTGACCCCCATGGGGAGGCAAGAAGCCGGCA

GCCACCCAACAACTTTGTACATTTCTCATTCTGTAGCGTTTGTCATGAAATTGCTTCTCCAGTCTAACCCGCCTGATGTGCATCTACTATTTCCAGGAGA

GTCTGCTCCCAGACACTCTGCCTTTCCCTCCAAAACCCTCTCACTCCCAGCTCGTGCAAACTGGTTACACAGCAGAAACGCAAAATAAAGAGGTGGCTTT

CGC
Translation
MVWKWLGALVVFPLQMIYLVTKAAVGMVLPPKLRDLSRESVLITGGGRGIGRHLAREFAERGARK - UNI35136 - IVLWGRTEKCLKETTEEIRQM

GTECHYFICDVGNREEVYQMAKAVREK VGDITILVNNAAVVHGKSLMDSDDDALLKSQHVNTLGQFW TTKAFLPRMLELQNGHIVCLNSVLALSAIPG

AIDYCTSKASAFAFMESLTLGLLDCPGVSATTVLPFHTSTEMFQGMRVR RFPNLFPPLKPETVARRTVDAVQQNQALLLLPWTMNILIILKS SILPQA

ALEEIHRFSGTYTCMNTFKGRT
Transcript ENSMUST00000105745
Sequence
AACGGCTGTTGGGGCAAGAAACTTCTTGTTAAAACTTCCCACCCCTTGGACTCTCCACAGCCCCTCTCACCGTCCCAATCTTCTGAGACGCTTTTTACCT

CTCCGCCAGAGCAGAGTTTATCTTTTTTTTCTTTTTCTTTTTTTTTTCTTTTTCCTCCCATTTTTCCTCGCCCTGTCCTTTACATCTGAAAGGAGATCAG

TTCAAGAGTGACCAGGTGGGACGCCTCCTTTTCCTTATTTAGTTTATTATTGTTTGGGGGAGTTTTCTTTCTATCTTTTTTTAATTCCTGTCCGGGGAGT

TTTGTCCACCGCCTCCTACCACCTCCCCCTGTACCCCGCTCCTCCGCGCGGAGGATGGTGTGGAAATGGCTGGGCGCGCTGGTAGTGTTCCCTCTGCAAA

TGATCTATTTGGTAACCAAAGCAGCCGTGGGAATGGTGTTGCCCCCCAAGCTTCGGGACTTGTCGCGGGAGTCAGTCCTCATCACCGGCGGTGGGAGAGG

CATCGGACGCCACCTCGCTCGGGAGTTCGCAGAGCGTGGCGCCAGAAAG - UNI35136 - ATTGTTCTCTGGGGGCGGACTGAAAAATGCCTCAAGG

AGACGACAGAGGAGATTCGGCAGATGGGCACAGAGTGCCACTACTTCATCTGTGACGTGGGCAACCGGGAAGAGGTGTACCAGATGGCCAAAGCTGTCCG

AGAGAAG ACCACCAAGGCCTTTTTGCCACGTATGCTGGAACTCCAGAACGGCCATATTGTGTGCCTCAATTCCGTGCTTGCACTGTCAGCCATCCCTGG

CGCCATCGACTACTGCACGTCAAAAGCATCAGCCTTCGCCTTCATGGAGAGCCTGACCTTGGGGCTGTTGGACTGTCCTGGTGTCAGCGCCACCACCGTT

CTGCCCTTTCACACCAGCACCGAGATGTTCCAGGGCATGAGAGTCAG GTTTCCCAACCTCTTCCCGCCACTGAAGCCAGAGACAGTAGCCCGGAGGACG

GTAGATGCTGTGCAACAAAACCAGGCCCTTCTCTTGCTCCCGTGGACCATGAATATCCTCATTATCTTGAAAAG CATACTCCCACAAGCTGCACTGGAG

GAGATTCACAGGTTCTCGGGGACTTACACCTGTATGAACACCTTTAAGGGGAGGACATAGAGGCAGGAGGAAGACACACCTGAGGAGCTATGGAGCCTGA

GGGGGAGCCACAGCAGCCGGGCACACAATCCTGTGCCTGTGCATTAGCACATCTGCTGGGTGAACAGGACTGTTCTTGTCCCCAGGGAAGATTTTGCAGC

TCCCCAGGTCAACTCCAGGACCTTTGTGCAAGACTGATGGGTTTAACTCTGACCCCCATGGGGAGGCAAGAAGCCGGCAGCCACCCAACAACTTTGTACA

TTTCTCATTCTGTAGCGTTTGTCATGAAATTGCTTCTCCAGTCTAACCCGCCTGATGTGCATCTACTATTTCCAGGAGAGTCTGCTCCCAGACACTCTGC

CTTTCCCTCCAAAACCCTCTCACTCCCAGCTCGTGCAAACTGGTTACACAGCAGAAACGCAAAATAAAGAGGTGGCTTTCGC
Translation
MVLPPKLRDLSRESVLITGGGRGIGRHLAREFAERGARK - UNI35136 - IVLWGRTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQMAKAVRE

K TTKAFLPRMLELQNGHIVCLNSVLALSAIPGAIDYCTSKASAFAFMESLTLGLLDCPGVSATTVLPFHTSTEMFQGMRVR RFPNLFPPLKPETVARR

TVDAVQQNQALLLLPWTMNILIILKS SILPQAALEEIHRFSGTYTCMNTFKGRT
Transcript ENSMUST00000105744
Sequence
TTTAAGCAATTTCCTGAGCCCAAGAATAGCAATGAGTCGGGAGACTTTCGCGGACTGAAATTGGGAGCTGCAATCACTCCCCAG CCGTGGGAATGGTGT

TGCCCCCCAAGCTTCGGGACTTGTCGCGGGAGTCAGTCCTCATCACCGGCGGTGGGAGAGGCATCGGACGCCACCTCGCTCGGGAGTTCGCAGAGCGTGG

CGCCAGAAAG - UNI35136 - ATTGTTCTCTGGGGGCGGACTGAAAAATGCCTCAAGGAGACGACAGAGGAGATTCGGCAGATGGGCACAGAGTGCC

ACTACTTCATCTGTGACGTGGGCAACCGGGAAGAGGTGTACCAGATGGCCAAAGCTGTCCGAGAGAAG ACCACCAAGGCCTTTTTGCCACGTATGCTGG

AACTCCAGAACGGCCATATTGTGTGCCTCAATTCCGTGCTTGCACTGTCAGCCATCCCTGGCGCCATCGACTACTGCACGTCAAAAGCATCAGCCTTCGC

CTTCATGGAGAGCCTGACCTTGGGGCTGTTGGACTGTCCTGGTGTCAGCGCCACCACCGTTCTGCCCTTTCACACCAGCACCGAGATGTTCCAGGGCATG

AGAGTCAG GTTTCCCAACCTCTTCCCGCCACTGAAGCCAGAGACAGTAGCCCGGAGGACGGTAGATGCTGTGCAACAAAACCAGGCCCTTCTCTTGCTC

CCGTGGACCATGAATATCCTCATTATCTTGAAAAG CATACTCCCACAAGCTGCACTGGAGGAGATTCACAGGTTCTCGGGGACTTACACCTGTATGAAC

ACCTTTAAGGGGAGGACATAGAGGCAGGAGGAAGACACACCTGAGGAGCTATGGAGCCTGAGGGGGAGCCACAGCAGCCGGGCACACAATCCTGTGCCTG

TGCATTAGCACATCTGCTGGGTGAACAGGACTGTTCTTGTCCCCAGGGAAGATTTTGCAGCTCCCCAGGTCAACTCCAGGACCTTTGTGCAAGACTGATG

GGTTTAACTCTGACCCCCATGGGGAGGCAAGAAGCCGGCAGCCACCCAACAACTTTGTACATTTCTCATTCTGTAGCGTTTGTCATGAAATTGCTTCTCC

AGTCTAACCCGCCTGATGTGCATCTACTATTTCCAGGAGAGTCTGCTCCCAGACACTCTGCCTTTCCCTCCAAAACCCTCTCACTCCCAGCTCGTGCAAA

CTGGTTACACAGCAGAAACGCAAAATAAAGAGGTGGCTTTCGCA
Translation
 MVLPPKLRDLSRESVLITGGGRGIGRHLAREFAERGARK - UNI35136 - IVLWGRTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQMAKAVR

EK TTKAFLPRMLELQNGHIVCLNSVLALSAIPGAIDYCTSKASAFAFMESLTLGLLDCPGVSATTVLPFHTSTEMFQGMRVR RFPNLFPPLKPETVAR

RTVDAVQQNQALLLLPWTMNILIILKS SILPQAALEEIHRFSGTYTCMNTFKGRT

For any suggestions or comments, please send an email to unitrap@crg.es