Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000066036 (Ubr4)
Chromosomal location
Chr 4: 138936602 - 139045444 (+)
Description
ubiquitin protein ligase E3 component n-recognin 4 Gene [Source:MGI (curated);Acc:Ubr4-001]
UniGene
Mm.410718 
MGI
MGI:1916366 
Uniprot/SWISSPROT
A2AN08 
Uniprot/SPTREMBL
A2VCS3 
Human Ortholog
ENSG00000127481 (UBR4)
Omim not available
UniTrap UNI22031
Vector Insertion
Chr 4: 138936778 - 138944282
Public Clones (sanger)
Private Clones OST311095 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5587
Vector Insertion
Chr 4: 138944381 - 138946754
Public Clones YTA276 (baygenomics) RHA015 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23815
Vector Insertion
Chr 4: 138946859 - 138947699
Public Clones not available
Private Clones OST244047 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11755
Vector Insertion
Chr 4: 138948802 - 138948931
Public Clones W033F06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12331
Vector Insertion
Chr 4: 138949335 - 138952471
Public Clones A022E02 (ggtc) A022F02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21901
Vector Insertion
Chr 4: 138958748 - 138962393
Public Clones not available
Private Clones OST314427 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6454
Vector Insertion
Chr 4: 138966186 - 138966321
Public Clones CSA130 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6560
Vector Insertion
Chr 4: 138968663 - 138969326
Public Clones YHB112 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10835
Vector Insertion
Chr 4: 138971125 - 138972467
Public Clones P097E07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9288
Vector Insertion
Chr 4: 138972872 - 138973105
Public Clones XH027 (baygenomics) XH028 (baygenomics) XH031 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4306
Vector Insertion
Chr 4: 138973305 - 138974316
Public Clones AG0148 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1598
Vector Insertion
Chr 4: 138977294 - 138977611
Public Clones CC0009 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4331
Vector Insertion
Chr 4: 138977840 - 138978307
Public Clones AF0829 (sanger) AE0499 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12196
Vector Insertion
Chr 4: 138984607 - 138985406
Public Clones A037E07 (ggtc) PST9598-NR (escells) PST8342-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11406
Vector Insertion
Chr 4: 138986256 - 138987459
Public Clones A055E01 (ggtc) W068C01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3385
Vector Insertion
Chr 4: 138989599 - 138989908
Public Clones XP0393 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2616
Vector Insertion
Chr 4: 138993964 - 138994077
Public Clones XR0746 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5145
Vector Insertion
Chr 4: 138996457 - 138996559
Public Clones YTC169 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6904
Vector Insertion
Chr 4: 138998600 - 138998739
Public Clones BGB003 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9067
Vector Insertion
Chr 4: 139001773 - 139001891
Public Clones XK191 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29171
Vector Insertion
Chr 4: 139007240 - 139007642
Public Clones not available
Private Clones OST6723 (lexicon)
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI89
Vector Insertion
Chr 4: 139021383 - 139023127
Public Clones GC0373 (tigem)
Private Clones not available
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6753
Vector Insertion
Chr 4: 139036752 - 139038372
Public Clones HMA164 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17371
Vector Insertion
Chr 4: 139038598 - 139041199
Public Clones not available
Private Clones OST443818 (lexicon)
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18868
Vector Insertion
Chr 4: 139042063 - 139045081
Public Clones not available
Private Clones OST412732 (lexicon) OST68843 (lexicon) OST26904 (lexicon) OST14873 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000097822
Sequence
ATGGCGACGAGCGGCGGCGAAGAGGCGGCGGCAGCAGCTCCAGCGCCCGGAGCCCCGGCGACCGGGCAGGACACGACCCCGGGCTGGGAGGTGGCGGTGC

GGCCCCTCCTGTCCGCGTCCTACTCCGCCTTCGAGATGAAGGAGTTGCCGCAGCTGGTGGCCTCAGTCATCGAGAG - UNI22031 - TGAGTCAGAA

ATCCTGCACCACGAGAAGCAGTACGAGCCGTTCTACTCCTCCTTTGTCGCACTGTCCACGCACTACATCACCACGGTCTGCAGCCTCA - UNI5587 -

 TTCCCCGGAACCAGCTTCAGTCGGTGGCAGCTGCCTGTAAAGTTCTCATTGAGTTTTCCCTCCTGCGTCTGGAGAACCCTGACGAGGCATGTGCTGTAT

CCCAG - UNI23815 - AAACACTTGATTCTGCTGATAAAAGGCCTGTGCACTGGCTGTAGCCGACTAGACAGAACAGAGATTATCACCTTTACAGCA

ATGATGAAGTCCGCCAAGCTTCCACAGACAGTGAAGACGCTTTCAGACG TGGAAGATCAGAAAGAGCTGGCCTCCCCAGTAAGCCCCGAGCTCAGGCAG

AAGGAGGTACAGATGAACTTTTTGAACCAGCTGACCTCAGTTTTTAACCCTAGAACTGTACCATCTCCTCCCATCAGTCCACAGGCTCTG GTGGAAGGA

GAAAATGATGAGCAGTCATCTCCAGATCAGGTCTCTGCTGCCAAGACCAAGAGTGTGTTCATAGCTCAGAATGTGGCTAGCCTTCAAGAGCTTG - UNI

11755 - GGGGTTCCGAGAAGCTACTCCGAGTATGCCTGAACCTGCCCTATTTCCTGCGCTACATCAATCGGTTTCAGGATGCTGTGGTGGCCAATTCC

TTCTTCATCATGCCAGCAACAGTAGCTGATGCCACCGCTGTTCGAAATGG TTTTCACTCACTGGTGATTGATGTAACCATGGCCTTGGATACCCTTTCC

CTGCCTGTGCTGGAACCCCTCAATCCTTCTCGTCTGCAAGATGTGACAGTGCTCAGCCTCAGCTGTCTGTATGCAG - UNI12331 - GTGTGAGTGT

AGCCACGTGTATGGCCATCCTTCATGTGGGTAGTGCCCAGCAAGTGCGGACAGGGTCCACAAGCTCCAAAGAAGATGACTACGAAAGTGATGCAGCCACG

ATTGTTCAGAAATGT CTTGAGATCTACGACATGATTGGACAGGCCATCAGCAGCTCCCGCCGCGCAGGTGGTGAG CACTTCCAGAACTTCCAGCTGTT

GGGCGCCTGGTGCCTGCTTAATAGCCTCTTCCTCATACTGAACCTCAGCCCCACAGCCCTGGCTGACAAGGGGAAAGAGAAGGACCCATTGGCTGCCCTT

CGCGTCAGAGACATCCTTTCTCGTACAAAGGAGGGAGTGGGCTCTCCCAAACTGGGGCCTGGCAAAGG GCATCAGGGATTTGGGGTACTCTCGGTGATA

CTGGCAAACCATGCCATCAAGCTGCTGGCGTCTCTCTTTCAAGACTTGCAGGTGGAGGCACTCCACAAG GGCTGGGAGACAGATGGCCCCCCTGCAGTC

CTGAGTATTATGGCCCAGAGCACCTCCACACAAAGGATTCAACGGCTGATTGACTCTGTCCCACTGACAAACCTGCTCTTGACTTTACTTTCAACTTCAT

ACAGAAAG GCGTGTGTCCTGCAGCGGCAGAGGAAGGGCTCCATGAGCAGTGATGCCAGCGCCTCCACCGACTCCAACACGTACTATGAGGATGACTTCA

GTAGCACAGAGGAGGACAGCAGCCAAG ATGATGACAGTGAGCCTATTTTGGGGCAGTGGTTTGAGGAGACCATCTCTCCCAGTAAAGAAAAAGCTGCGC

CTCCACCTCCTCCACCACCCCCTCCCCTGGAGAGCTCTCCTCGGGTTAAAAGCCCCAATAAGCAGGCATCTGGTGAGAAGGGCAACATCTTGGCCAGCCG

CAAAGACCCTGAGTTG TTCTCAGGCCTGGCTTCCAACATCCTGAACTTCATCACGACTTCCATGCTGAACTCTCGAAACAGTTTCATCCGGAGCTATCT

GAGCGCCTCTCTCTCAGAGCACCACATGGCCACTCTGGCCAGCATCATTAAGGAGGTGGACAAAGATGGACTCAAGG GGTCATCAGATGAGGACTTTGC

TGCTGCTCTCTATCACTTCAACCACTCGCTGGTGACTTCTGACCTACAGTCCCCAAACCTGCAG - UNI21901 - AATACACTGCTCCAGCAGCTGG

GAGTTGCTCCTTTCTCCGAAGGCCCTTGGCCCCTGTACATTCACCCCCAAGGCCTCTCTGTGCTTTCTCGCCTCCTGCTTATCTGGCAGCATAAAGCTGG

AGCCCAAGGTGACCCTGATGTCCCTGAATGCCTGAAAGTGTGGGACAG GTTTTTAACTACCATGAAGCAGAATGCACTGCAGGGGGTGGTGCCCAGTGA

GACAGAAGACCTGAACGTTGAGCACCTGCAGCTGCTGCTGCTCATCTTCCACAGCTTCTCTGAGAAGGGCCGCAGAGCCATCTTGACCATGCTTGTGCAG

AGCATCCAGGAGCTGAGTGTTAACATGGAGGTGCAGATGCGCACTGCACCGCTGATCCTGGCCCGCCTCCTCTTGATCTTTGACTACCTACTTCATCAGT

ACTCCAAAGCCCCCGTGTATCTGTTTGAGCAG GTGCAGCACAATCTGCTAAGTCCCCCTTTTGGGTGGGCAAGTGGATCCCAAGACAGCAGCAGCCGCC

GAGCCAACACTCCTCTGTATCATGGCTTCAAGGAAGTAGAAGAAAATTGGTCCAAACATTTTTCATCAG ATGCGGCCCCACAACCCAGGTTCTACTGCG

TCCTGTCCACAGAGGCCTCTGAGGAGGATTTGAACCGGCTGGATTCTGAG GCATGTGAAGTTCTTTTCTCCAAGCCTGTCAAGTACGATGAACTTTATT

CCTCACTGACTACCCTGCTCGCGGCTGGATCTCAGCTGGATACAACCAGGAGGAAGGAAAAGAAGAACGTGACAGCCCTG GAGGCCTGCGCCCTGCAGT

ATTACTTCTTGATTCTCTGGAGGATCTTAGGAATTTTGCCACCTTCAAAGACTTACATGAACCAGCTGGCCATGAATTCACCTGAGATGAGTGAATGTGA

CATCTTACACACTCTGCGATGGTCGTCTCGCCTCCGGATCAGTTCCTATGTCAGCTGGATAAAG - UNI6454 - GATCACCTTATCAAACAAGGCAT

GAAGCCCGAGCATGCGGGCTCTCTCATAGAACTGGCTGCCAGCAAGTGTAGTTCAGTGAAGTACGATGTTGAGATTGTAGAGGAGTACTTTGCCCGACAG

 ATCTCGTCCTTCTGCTCCATTGACTGCACTGCCGTCCTCCAGCTGCATGAGATCCCCAGTCTGCAGTCCATCTACACCCTGGATGCCGCTGTCTCGAAG

GTCCAGGTCTCTCTGGATGAGCACTTCTCTAAGATGGCCGCAGAGACCGACCCCCATAAGTCATCTGAGATCACCAAGAACCTCCTTCCAGCTACGCTGC

AGCTCATTGACACCTATGCCTCGTTCACCAG AGCCTATCTGCTGCAGAACCTTAATGAAGAGGGGTCCACTGAGAAGCCCTCCCAGGAGAAGCTGCATG

GCTTTGCAGCTGTCTTGGCTATCGGCTCCAGTAGGTGCAAGGCAAACACACTGG - UNI6560 - GACCAACTCTAGTGCAGAATTTACCGTCATCAG

TGCAGTCTGTCTGTGAGTCCTGGAATAACATCAATACCAATGAGTTTCCCAACATTGGATCCTGG CGCAATGCATTTGCCAACGACACCATCCCGTCCG

AGAGTTACATCAGTGCCGTGCAGGCTGCTCACCTGGGGACTCTGTGTGGCCAGAGTCTGCCCCTGGCGGCTTCCCTGAAACATACCCTCCTCTCCCTGGT

CAGGTTGACTGGGGATCTGATTGT GTGGTCAGATGAGATGAACCCAGCACAGGTGATCCGGACTCTGTTACCGCTTCTCTTGGAGTCAAGCACAGAGAG

CGCTGCTGAGATCAGCAGTAACTCTCTGGAGCGCATCTTGGGACCTGCGGAGTCTGATGAGTTCCTGGCTCGTGTGTATGAGAAGCTGATCACGGGATGT

TACAACATTCTGGCCAACCATGCAGATCCCAACAG - UNI10835 - TGGGCTGGATGAGTCCATCCTGGAGGAGTGTTTACAGTATCTGGAGAAGCA

GCTGGAGAGCAGCCAGGCCCGGAAGGCCATGGAGGAGTTCTTCTCTGATGG TGGGGAGCTGGTGCAGATCATGATGGCCACAGCCAATGAGGACCTCTC

TGCTAAATTCTGTAACCGAGTCTTGAAATTCTTCACCAAACTCTTCCAGCTGA - UNI9288 - CTGAGAAGAGCCCTAACCCGAGCCTCCTTCACCT

CTGTGGCTCTCTCGCCCAGCTTGCGTGTGTGGAGCCGGTACGCCTGCAGGCCTGGCTCACCCGCATGACAACATCGCCCCCGAAGGATTCTGACCAGCTG

GAGGTCATTCAGGAGAACCGGCAGCTGCTGCAGTTACTGACCACGTACATCGTTCGGGAGAACAG - UNI4306 - CCAAGTTGGAGAAGGTGTGTGT

GCTGTGCTTCTGGGCACCCTGACCCCCATGGCAACAGATATGCTGGCGAACGGTGATGGGACCGGCTTCCCTGAGCTCATGGTTGTGATGGCCACTCTAG

CCAGTGCCGGGCAAGGAGCTGGCCACCTTCAGCTTCACAATGCTGCAGTGGACTGGCTGGGCAGATG CAAGAAATACCTGTCACAGAAGAACGTGGTTG

AGAAGCTGAATGCCAATGTAATGCATGGAAAG CATGTGATGGTCTTGGAGTGCACATGTCATATTATGTCTTACCTGGCCGATGTCACAAATGCCCTGA

GCCAGAGTAATGGTCAAGGCCCAAGCCATCTGTCAGTGGATGGGGAAGAGCGTGCCATTGAGGTGGATTCAGACTGGGTGGAAGAGTTAGCGGTGGAGGA

GGAAGACTCCCAGGCTGAGGACTCT GATGAAGATTCTCTTTGCAATAAGCTGTGTACCTTCACCATCACACAGAAGGAGTTTATGAACCAGCATTG GT

ACCACTGTCATACCTGTAAGATGGTGGATGGGGTGGGTGTGTGCACAGTGTGTGCAAAGGTATGCCATAAGGACCATGAGATTTCCTACGCCAAGTATGG

TTCCTTTTTCTGTGACTGTGGAGCCAAGGAAGATGGCAGCTGCTTG - UNI1598 - GCCCTGGTGAAGCGAACTCCTAGCAGTGGCATGAGCTCTAC

CATGAAGGAGTCAGCATTTCAGAGCGAACCTAGGGTTTCCGAAAGTCTGGTGCGCCATGCCAGCACCTCTCCTGCTGACAAGGCCAAGGTCACCATCAGT

GATGGGAAGGTTACAGATGAAGAGAAGCCCAAGAAGAGCAGCCTGTGCCGTACAGTTGAGGGGTGTCGTGAGGAGCTGCAGAATCAG - UNI4331 - 

GCCAATTTCTCCTTCGCTCCTCTCGTGTTAGACATGCTCAGTTTCCTCATGGATGCCATTCAGACCAACTTTCAGCAGGCTTCAGCCGTGGGGAGCAGCA

GCAGGGCCCAGCAGGCCCTCAGTGAACTGCACACAGTGGACAAGGGTGTGGAGATGACAGACCAGCTGATG GTTCCCACCTTAGGCTCACAGGAAGGTG

CCTTTGAGAATGTTCGGATGAATTACAGCGGAGACCAGGGCCAGACTATACGGCAGCTGATCAGTGCCCACGTGCTGAGACGGGTGGCTATGTGTGTGCT

TTCTTCCCCCCATGGGCGCCGCCAGCATTTGGCTGTTAGCCATGAGAAGGGCAAG ATCACAGTGCTGCAGCTCTCAGCGCTCCTGAAGCAAGCAGATTC

CAGTAAGAGGAAGCTGACGCTAACCCGCTTGGCTTCTGCCCCAGTTCCCTTCACAGTGCTGAGTCTTACTGGAAACCCCTGCAAGGAGGACTACCTGGCA

GTGTGTGGGCTGAAG GACTGCCACGTGCTCACCTTCAGCAGCTCAGGCTCTGTCTCCGATCACTTAGTGTTACATCCCCAGTTGGCCACAGGGAACTTC

ATCATCAAAGCTGTGTGGCTCCCTGGTTCACAGACTGAGCTAGCCATCGTCACCGCAGACTTCGTCAAG ATTTACGACCTGTCTATTGATGCCTTGAGT

CCAACCTTCTACTTCCTCCTGCCGAGCTCAAAGATAAGAGACGTTACCTTCCTTTTCAACGAGGAAGGCAAGAACATCATTGTCATCATGTCCTCTGCTG

GGTACATGTACACACAACTCATGGAGGAGGCCAGCAGTGCCCAGCAGGGCCCCTTCTATGTCACTAATGTGCTGGAAATAAATCACGAGGACCTGAAG G

ACAGTAACAGCCAGGTGGCAGGCGGTGGCGTGTCTGTGTACTACTCACACGTGTTGCAGATGCTTTTCTTCAGCTACAGTCAGGGCAGGTCCTTTGCAGC

CACTGTCAGCAGGAGCACCCTGGAGGTGTTGCAGCTCTTCCCCATCAACATCAAAAG CTCCAATGGTGGCAGTAAGACTTCTCCTGCCCTTTGCCAGTG

GTCCGAGGTGATGAACCACCCTGGCTTGGTGTGTTGTGTTCAGCAGACTACTGGCGTGCCTCTGGTGGTCATGGTGAAGCCAGGCACTTTCCTCATCCAG

GAGATTAAGACTCTTCCCGCCAAAGCAAAG ATCCAAGACATGGTTGCCATTAGGCACACTGCCTGCAATGAGCAGCAACGTACAACCATGATCCTGCTG

TGCGAGGACGGCAGCCTGCGGATTTACATGGCCAATGTAGAGAACACCTCTTACTGGCTCCAGCCGTCTCTGCAGCCCAGCAGTGTCATCAGCATCATGA

AACCTGTGCGGAAGCGCAAAACAGCTACCATCA - UNI12196 - CAGCCCGCACATCCAGCCAGGTCACCTTCCCCATTGACTTTTTTGAACACAAC

CAGCAGCTAACAGATGTGGAGTTTGGCGGTAATGACCTCTTGCAAGTCTACAATGCACAGCAGATAAAGCACAGGCTGAACTCCACTGGCATGTACGTGG

CTAACACCAAG CCTGGCGGCTTCACCATCGAGATCAGTAACAACAGCAGCACCATGGTGATGACGGGCATGCGGATCCAGATTGGGACGCAGGCCATCG

AGCGGGCCCCGTCCTACATCGAGATCTTCGGCAGGACCATGCAGCTGAACCTGAGCCGCTCCCGCTGGTTTGACTTCCCCTTCACCAGAGAGGAGGCCCT

GCAGGCCGACCGGAAGCTGAGCCTCTTCA - UNI11406 - TCGGTGCCTCCGTGGATCCAGCTGGTGTCACCATGATAGATGCTGTAAAAATTTATG

GCAAGACTAAAGAGCAGTTTGGCTGGCCTGATGAGCCCCCAGAAGACTTCCCTTCTGCCTCAGTCAGCAACATCTGCCCTCCTAACCTGAACCAGAGCAA

TGGCACTGGAGAGAGTGACTCAGCCGCCCCTGCCACAACCAGTGGCACTGTCCTGGAGAG GCTGGTTGTGAGTTCTTTGGAAGCCCTGGAAAGCTGCTT

TGCTGTTGGCCCAATCATTGAGAAG - UNI3385 - GAGAGAAACAAGCATGCCGCTCAGGAGCTAGCCACTTTGTTGCTCTCCCTGCCAGCGCCTGC

CAGTGTCCAGCAGCAATCAAAGAGCCTCCTGGCCAGTCTGCACAGCAGCCGCTCGGCCTACCACAGCCATAAG GACCAGGCCTTGTTGAGCAAAGCTGT

GCAGTGTCTCAACACATCCAGCAAAGAAGGCAAGGACTTGGACCCCGAGGTGTTCCAGCGCCTGGTGATCACAGCTCGCTCCATTGCCGTCACACGCCCT

AACAACCTTGTGCACTTCACCGAGTCAAAGCTGCCCCAGATGGAAACAG AAGGAGCAGATGAGGGGAAAGAGCCGCAGAAGCAGGAAGGAGACGGCTGT

AGTTTCATCACTCAGCTTGTAAACCACTTCTGGAAACTCCATGCATCTAAGCCCAAGAATGCCTTCCTGGCACCTGCCTGCCTGCCAG GCCTTACTCAT

ATTGAAGCTACGGTTAATGCGTTGGTAGACATTATCCACGGTTATTGTACCTGCGAGCTGGACTGTATCAACACAGCATCCAAGATCTACATGCAGATGC

TGCTGTGTCCT - UNI2616 - GACCCTGCTGTGAGCTTCTCCTGTAAACAAGCTCTGATTCGAGTCCTAAGGCCCAGGAACAAGCGGAGACACGTGA

CGTTGCCCTCCTCCCCTCGAAGCAACACTCCAATGG - UNI2616 - GAGACAAGGACGACGATGATGACGATGACGCAGATGAGAAAATGCAGTCAT

CGGGCATCCCCGATGGTGGTCACATCCGCCAGGAAAGCCAGGAACAGAGTGAGGTGGACCATGGAGATTTTGAGATGGTG - UNI5145 - TCTGAGT

CGATGGTCCTGGAAACAGCTGAAAATGTCAACAATGGCAACCCCTCTCCCCTGGAGGCCCTGCTGGCAGGTGCTGAAGGCTTTCCTCCCATGCTGGACAT

CCCACCTGATGCAGACGACGAGACCATGGTTGAACTAGCCATTGCCCTGAGCCTGCAGCAGGACCAGCAAG GCAGCAGCAGCAGTGCCCTGGGCCTGCA

GAGCCTGGGACTCTCCGGCCAGGCACCCAGCTCTTCCTCTCTGGACGCAGGAACCCTCTCTGACACCACAGCATCAG - UNI6904 - CTCCAGCCTC

AGATGACGAGGGCAGCACTGCAGCAACTGACGGCTCCACCCTGCGGACCTCGCCAGCTGACCATGGCGGTAGTGTGGGCTCAGAGAGCGGGGGAAGTGCA

GTGGACTCGGTGGCTGGCGAGCACAGTG - UNI6904 - TGTCTGGCCGGAGCAGTGCATATGGTGACGCCACAGCTGAGGGGCACCCGGCTGGACCA

GGGAGCGTCAGCTCTAGCACAGGCGCCATCAGCACCGCCACTGGGCACCAGGAGGGAGACGGCTCTGAGGGAGAAGGAGAAGGGGAAGCTGAAGGAGATG

TGCACACTAGCAACAG GCTACACATGGTTCGTCTGATGCTGTTGGAAAGATTGCTGCAGACACTGCCCCAGTTACGGAATGTCGGAGGTGTCCGGGCCA

TCCCATACATGCAG GTCATTCTCATGCTCACTACAGATCTCGATGGAGAAGATGAGAAAGACAAGGGAGCCCTGGACAACCTGCTTGCACAGCTCATCG

CCGAGTTGGGCATGGACAAAAAG - UNI9067 - GATGTCTCCAAGAAGAACGAGCGCAGTGCTCTGAATGAAGTCCATTTGGTCGTGATGAGACTCC

TGAGTGTCTTCATGTCTCGTACCAAGTCTGGATCCAAATCTTCCATCTGTGAG - UNI9067 - TCCTCTTCCCTCATCTCCAGTGCCACGGCAGCAG

CCCTGCTTAGCTCAGGGGCTGTGGACTATTGCCTCCATGTGCTCAAGTCTCTGCTGGAATACTGGAAGAGCCAGCAGAGTGATGAGGAGCCTGTGGCTGC

CAGCCAACTGCTGAAACCACACACGACTTCATCTCCGCCAGATATGAGCCCATTCTTTCTCCGCCAGTATGTGAAG GGCCATGCCGCTGATGTCTTTGA

AGCCTATACCCAGCTGCTCACAGAGATGGTACTGAGGCTTCCCTACCAAATCAAGAAGATCGCAGACACCAGCTCTCGGATTCCTCCTCCTGTCTTTGAT

CACTCCTGGTTCTACTTCCTCTCTGAG TACCTAATGATCCAGCAGACCCCTTTTGTCCGCCGACAAGTTCGAAAACTTCTGCTCTTCATCTGTGGATCA

AAGGAGAAATACCGACAGCTCCGAGACCTGCACACCCTGGACTCCCATGTGCGTGGGATCAAGAAGCTGCTGGAGGAGCAGGGCATCTTCCTCCGGGCCA

GTGTGGTCACAGCCAGTTCCGGCTCCGCTTTGCAGTATGACACGCTCATCAGCCTG ATGGAGCATCTGAAGGCCTGTGCAGAGATTGCCGCCCAGCGAA

CCATCAACTGGCAGAAGTTCTGCATCAAAGATGACT - UNI29171 - CTGTCCTGTACTTCCTCCTGCAAGTGAGTTTCCTGGTAGATGAGGGGGTG

TCCCCCGTGCTGCTGCAGCTGCTCTCCTGTGCTCTGTGCGGCAGCAAAGTGCTCGCAGCCCTGGCGGCCTCCACAGGGTCTTCCAGTGTGGCTTCCTCCT

CAGCCCCTCCTGCAGCCAGTTCTGGACAAGCCACAACTCAGTCCAAATCTTCCACTAAAAAGAGCAAGAAAGAAGAAAAGGAAAAAGAGAAAGAGG GTG

AGAGCTCTGGTAGCCAGGAGGACCAGCTGTGCACAGCTCTCGTGAACCAGCTGAACAGATTTGCAGACAAAGAAACTCTGATCCAGTTTCTGCGCTGTTT

CCTGTTGGAGTCCAACTCGTCCTCAGTGCGCTGGCAGGCCCACTGCCTGACACTGCACATCTACAG AAACTCCAACAAGGCTCAGCAGGAGCTCTTGCT

AGATCTCATGTGGTCCATCTGGCCGGAATTGCCAGCTTACGGCCGGAAGGCTGCCCAGTTTGTGGACCTGCTGGGCTATTTCTCCCTGAAAACTGCACAG

ACAGAGAAGAAG TTGAAGGAGTATTCCCAGAAGGCCGTGGAGATCCTGAGGACTCAGAACCATATCCTCACCAATCACCCCAACTCCAACATCTACAA 

CACCTTGTCTGGCTTAGTGGAGTTTGACGGCTATTACCTAGAGAGCGACCCCTGCCTGGTGTGTAACAATCCTGAGGTGCCGTTTTGT TATATCAAGCT

GTCTTCCATTAAAGTGGACACACGGTACACCACCACCCAGCAGGTTGTAAAGCTCATTGGCAGTCACACCATCAGCAAGGTGACAGTGAAAATTGGGGAC

CTGAAGCGAACCAAGATGGTGCGGACGATCAACCTGTACTACAACAACCGAACTGTGCAGGCCATCGTGGAGCTGAAAAATAA GCCAGCTCGCTGGCAC

AAAGCCAAGAAAGTTCAGCTGACTCCCGGACAGACAGAAGTCAAGATTGACCTGCCTCTGCCCATCGTGGCCTCTAACCTGATGATCGAGTTTGCAGACT

TCTATGAGAACTACCAGGCCTCCACAGAGACCCTTCAATGTCCTCGCTGCAGTGCCTCTGTCCCCGCCAACCCAGGCGTCTGTGGCAACTGTGGAGAGAA

TGTATACCAGTGTCACAAGTGCAG GTCCATCAACTATGATGAAAAGGACCCCTTCCTCTGCAATGCTTGTGGCTTCTGTAAATACGCCCGCTTTGACTT

CATGCTTTATGCCAAGCCTTGCTGTGCAGTGGATCCCATCGAGAACGAAGAAGATCGGAAGAAG GCCGTTTCCAACATCAACACACTTCTGGACAAAGC

TGACCGCGTGTACCATCAGCTCATGGGACATCGGCCCCAGTTGGAGAACCTGCTCTGCAAAGTGAATGAAGCAGCTCCAGAAAAGCCACAG GAAGACTC

AGGAACAGCGGGAGGCATCAGCTCCACTTCAGCCAGTGTGAATCGCTACATCCTGCAGCTGGCTCAAGAGTATTGTGGAGACTGTAAGAACTCGTTCGAT

GAGCTCTCCAAAATCATCCAG AAAGTTTTTGCTTCACGCAAAGAGCTGTTGGAATATGATCTACAGCAAAGAGAAGCAGCCACCAAGTCATCCCGGACG

TCTGTCCAGCCCACGTTTACTGCCAGCCAGTACCGTGCTTTGTCTGTCTTAGGCTGTGGCCACACCTCCTCCACCAAGTGCTATGGCTGTGCCTCAGCTG

TCACGGAGCATTGTATTACACTACTGAGGGCCCTGGCCACCAATCCAGCCCTGCGACACATCCTCGTCTCCCAGGGCCTCATCCGAGAGCTCTTTGATTA

CAACCTCCGCCGTGGCGCTGCAGCCATTCGAGAGGAGGTCCGCCAGCTCATGTGCCTCCTCACCAG AGACAACCCAGAGGCCACCCAGCAAATGAACGA

CCTGATCATTGGCAAAGTCTCCACTGCACTGAAGGGCCACTGGGCTAATCCTGACCTG GCTAGCAGCCTTCAGTATGAGATGCTGCTGCTGACAGATTC

CATCTCCAAGGAGGACAGCTGCTGGGAACTCCGCTTACGATGTG CACTCAGCCTTTTCCTCATGGCTGTGAACATCAAAACGCCAGTGGTTGTTGAGAA

TATCACACTCATGTGTCTGCGGATCTTACAGAAGCTGATTAAACCACCTGCCCCAACCAGCAAGAAGAACAAG GATGTCCCCGTGGAGGCCCTCACCAC

AGTGAAACCGTACTGCAATGAGATCCATGCCCAGGCTCAGCTGTGGCTCAAGAGAGATCCCAAGGCATCATACGAAGCCTGGAAGAAGTGCCTGCCTATC

CGAG GGGTGGATGGCAATGGGAAATCCCCCAGCAAGTCAGAGCTCCACCGTCTCTACTTGACCGAGAAGTACGTGTGGAGGTGGAAACAGTTCCTGAGC

CGGCGGGGGAAGAGGACCACCCCACTTGACCTCAAGCTGGGCCACAACAACTGGCTGCGGCAG GTACTCTTTACCCCAGCAACACAGGCAGCAAGGCAG

GCAGCCTGTACCATCGTGGAAGCTCTTGCTACTGTCCCCAGCCGCAAGCAGCAGGTCCTTGACCTCCTCACCAG TTACCTGGACGAGCTCAGCGTTGCG

GGGGAGTGTGCTGCAGAGTACCTGGCTCTCTACCAGAAGCTCATCGCCTCGTGCCACTGGAAGGTCTACCTAGCTGCACGCGGAGTCCTGCCCTACGTGG

GCAACCTCATCACCAAG GAAATCGCCCGCCTGCTGGCCTTGGAGGAGGCCACGCTGAGCACAGACCTGCAGCAGGGATATGCCCTCAAGAGTCTCACAG

 GCCTTCTCTCCTCCTTTGTAGAGGTGGAATCCATTAAGAGGCATTTTAAGAGCCGCTTAGTGGGCACTGTGCTGAATGGGTACCTGTGCTTGCGGAAGC

TGGTGCTGCAGAGGACCAAGCTCATCGACGAGACCCAGGACATGCTGCTGGAGATGCTGGAGGACATGACCACAG - UNI89 - GTACAGAGTCTGAA

ACCAAGGCCTTCATGGCTGTGTGCATTGAGACAGCAAAGCGCTACAATCTGGATGACTACCGGACTCCCGTGTTCATCTTTGAGAGGCTGTGCAGCATCA

TCTACCCT GAGGAGAATGAAGTCACGGAGTTCTTCGTGACCCTGGAGAAGGACCCCCAGCAAGAGGACTTTCTACAGGGCAGGATGCCCGGAAACCCAT

ATAGCAGCAATGAACCAGGCATTGGGCCTCTTATGAGGGACATAAAGAACAAGATCTGCCAGGACTGTGACCTAGTGGCTCTTCTGGAGGATGACAGTGG

GATGGAG CTCCTGGTGAACAATAAAATTATCAGTCTGGACCTTCCCGTGGCTGAGGTTTACAAGAAGGTGTGGTGTGCGACCAATGAG GGAGAGCCCA

TGAGGATTGTTTATCGAATGCGGGGGCTCCTGGGCGATGCCACCGAGGAGTTTATCGAGTCCCTGGACTCCACCACAG ATGAAGAAGAAGATGAAGAGG

AAGTGTACAGAATGGCCGGTGTGATGGCCCAGTGTGGGGGTCTGCAGTGCATGTTGAACAGACTGGCAGGAGTCAAAGATTTTAAGCAGGGACGCCACCT

TCTAACA GTGCTGCTGAAGCTCTTCAGTTACTGTGTGAAGGTCAAAGTCAACCGGCAGCAGCTGGTCAAGCTGGAGACGAACACTCTGAATGTCATGCT

GGGGACTCTGAACCTG GCTCTGGTAGCCGAGCAAGAGAGCAAGGACAGCGGAGGAGCAGCTGTGGCTGAGCAGGTGCTAAGCATCATGGAGATCATTCT

AGATGAATCCAACGCAGAGCCCCTGAGTGAGGACAAG GGCAACCTCCTCCTCACAGGTGACAAGGATCAACTGGTGATGCTCTTGGACCAGATCAACAG

CACCTTCGTTCGATCCAACCCTAGCGTGCTACAGGGCTTGCTGCGTATCATCCCATACCTGTCCTTCGGAGAGGTGGAGAAGATGCAGATCCTGGTGGAG

CGGTTCAAGCCATACTGCAGCTTCGAGAA GTACGATGAAGACCATAGTGGGGATGACAAAGTCTTCCTGGATTGCTTCTGCAAAATTGCTGCCGGTATC

AAGAACAACAGCAATGGTCATCAGCTGAAGGATCTCATCCTGCAGAAGGGAATCACCCAAAATGCCCTGGACTACATGAAAAAGCATATCCCCAGTGCCA

AGAA TTTGGATGCTGACATCTGGAAAAAGTTTTTGTCTCGCCCTGCTCTGCCATTTATTTTGAGGCTTCTTCGGGGTCTGGCCATGCAGCACCCTGCCA

CCCAG GTTCTGATTGGAACGGACTCCATCACGAGCCTGCATAAGCTGGAGCAGGTGTCCAGTGATGAGGGCATTGGGACCCTGGCTGAGAACCTGCTGG

AGGCCCTGAGAGAACACCCAGATGTGAACAAGAAGATTGACGCAGCCCGCAGGGAGACCCGGGCAGAGAAGAAGCGCATGGCCATGGCCATGAGGCAGAA

GGCTCTGGGAACTCTGGGCATGACG ACAAACGAAAAGGGTCAGGTGGTGACCAAGACTGCACTCCTGAAGCAGATGGAAGAGCTGATTGAGGAGCCGGG

ACTCACGTGCTGCATCTGCAGGGAGGGGTACAAGTTCCAG CCCACGAAGGTCTTAGGCATTTACACTTTCACCAAGCGGGTAGCCTTGGAGGAGATGGA

GAACAAGCCCCGGAAGCAGCAGGGCTACAGCACTGTGTCCCATTTCAACATTGTGCACTACGACTGTCACCTGGCTGCCGTCAG GTTGGCTAGAGGCCG

GGAAGAGTGGGAGAGTGCTGCCCTGCAGAACGCCAACACGAAGTGCAATGGGCTCCTTCCGGTCTGGGGCCCCCATGTCCCTGAATCAGCTTTCGCCACT

TGCTTAGCAAG GCACAACACGTACCTCCAGGAGTGTACCGGCCAGCGGGAGCCCACGTACCAGCTCAACATCCATGACATCAAACTGCTCTTCCTGCGC

TTCGCCATGGAGCAGTCATTCAGTGCAGACACCGGTGGGGGCGGCCGTGAGAGCAACATCCACCTGATCCCATACATCATTCACACTGTGCTTTACGTCC

TGAACAC - UNI6753 - GACCCGAGCAACGTCCCGGGAGGAGAAGAACCTCCAAGGCTTCCTGGAACAGCCCAAAGAGAAGTGGACAGAGAGTGCCT

TCGATGTAGATGGGCCCCACTACTTCACCATCCTAGCCCTGCACGTCCTCCCCCCTGAACAGTGGAAAGCCATTCGAGTAGAGATCCTACGCAGGCTGCT

GGTGGCCTCACATGCCCGGGCAGTGGCTCCAGGAGGAGCCACCAG - UNI17371 - GTTGACAGACAAGGCGGTGAAGGACTATTCTGCGTACCGTT

CTTCCCTGCTCTTCTGGGCTCTCGTCGATCTCATTTATAACATGTTTAAG AAGGTGCCCACTAGTAACACTGAGGGCGGCTGGTCCTGCTCTCTGGCCG

AGTACATCCGCCACAATGACATGCCCATCTACGAAGCTGCCGACAAAGCCCTGAAAACCTTCCAGGAGGAGTTCATGCCAGTGGAGACCTTCTCGGAGTT

CCTCGACGCAGCAG - UNI18868 - GTCTTCTATCAGAAATCACCGATCCAGAGAGCTTCCTAAAGGACCTGTTGAACTCAGTCCCCTGACCATCCC

CATGGAAATGAGATTGAAGCTAGCTTGCATTCTCCCCTCATTCATCTCTCCGTGTGCACTCATTTCCCCCACGGATGCTGCATTAGCACCCCCTCCTCCC

TCAGTTTTCTCGGAGTGGTTTGGGGTCTGTAGGCTTCCTGTTCTATCACGTGTGTGTGTGTGCTGCGCAGGCTATGAAGTTGTCTGTAGCTCAAGCCATT

GAAGGACCTATACGTACCTAGGAGCTGTGAGCTGTCCCGGCCAGCTTGAGTGTGTACATCTTGAAATAAATGAATGACTTAGTACACATTG
Translation
MATSGGEEAAAAAPAPGAPATGQDTTPGWEVAVRPLLSASYSAFEMKELPQLVASVIES - UNI22031 - SESEILHHEKQYEPFYSSFVALSTHYI

TTVCSLI - UNI5587 - IPRNQLQSVAAACKVLIEFSLLRLENPDEACAVSQ - UNI23815 - KHLILLIKGLCTGCSRLDRTEIITFTAMMKS

AKLPQTVKTLSDV VEDQKELASPVSPELRQKEVQMNFLNQLTSVFNPRTVPSPPISPQAL VEGENDEQSSPDQVSAAKTKSVFIAQNVASLQELG - 

UNI11755 - GGSEKLLRVCLNLPYFLRYINRFQDAVVANSFFIMPATVADATAVRNG GFHSLVIDVTMALDTLSLPVLEPLNPSRLQDVTVLSLSCL

YAG - UNI12331 - GVSVATCMAILHVGSAQQVRTGSTSSKEDDYESDAATIVQKC LEIYDMIGQAISSSRRAGGE HFQNFQLLGAWCLLNSLFL

ILNLSPTALADKGKEKDPLAALRVRDILSRTKEGVGSPKLGPGKG GHQGFGVLSVILANHAIKLLASLFQDLQVEALHK GWETDGPPAVLSIMAQSTS

TQRIQRLIDSVPLTNLLLTLLSTSYRK ACVLQRQRKGSMSSDASASTDSNTYYEDDFSSTEEDSSQD DDDSEPILGQWFEETISPSKEKAAPPPPPPP

PPLESSPRVKSPNKQASGEKGNILASRKDPEL FSGLASNILNFITTSMLNSRNSFIRSYLSASLSEHHMATLASIIKEVDKDGLKG GSSDEDFAAALY

HFNHSLVTSDLQSPNLQ - UNI21901 - NTLLQQLGVAPFSEGPWPLYIHPQGLSVLSRLLLIWQHKAGAQGDPDVPECLKVWDR RFLTTMKQNAL

QGVVPSETEDLNVEHLQLLLLIFHSFSEKGRRAILTMLVQSIQELSVNMEVQMRTAPLILARLLLIFDYLLHQYSKAPVYLFEQ VQHNLLSPPFGWASG

SQDSSSRRANTPLYHGFKEVEENWSKHFSSD DAAPQPRFYCVLSTEASEEDLNRLDSE ACEVLFSKPVKYDELYSSLTTLLAAGSQLDTTRRKEKKNV

TAL EACALQYYFLILWRILGILPPSKTYMNQLAMNSPEMSECDILHTLRWSSRLRISSYVSWIK - UNI6454 - DHLIKQGMKPEHAGSLIELAAS

KCSSVKYDVEIVEEYFARQ ISSFCSIDCTAVLQLHEIPSLQSIYTLDAAVSKVQVSLDEHFSKMAAETDPHKSSEITKNLLPATLQLIDTYASFTR RA

YLLQNLNEEGSTEKPSQEKLHGFAAVLAIGSSRCKANTLG - UNI6560 - GPTLVQNLPSSVQSVCESWNNINTNEFPNIGSW RNAFANDTIPSES

YISAVQAAHLGTLCGQSLPLAASLKHTLLSLVRLTGDLIV VWSDEMNPAQVIRTLLPLLLESSTESAAEISSNSLERILGPAESDEFLARVYEKLITGC

YNILANHADPNS - UNI10835 - SGLDESILEECLQYLEKQLESSQARKAMEEFFSDG GGELVQIMMATANEDLSAKFCNRVLKFFTKLFQLT - 

UNI9288 - TEKSPNPSLLHLCGSLAQLACVEPVRLQAWLTRMTTSPPKDSDQLEVIQENRQLLQLLTTYIVRENS - UNI4306 - SQVGEGVCAV

LLGTLTPMATDMLANGDGTGFPELMVVMATLASAGQGAGHLQLHNAAVDWLGRC CKKYLSQKNVVEKLNANVMHGK HVMVLECTCHIMSYLADVTNAL

SQSNGQGPSHLSVDGEERAIEVDSDWVEELAVEEEDSQAEDS DEDSLCNKLCTFTITQKEFMNQHW WYHCHTCKMVDGVGVCTVCAKVCHKDHEISYA

KYGSFFCDCGAKEDGSCL - UNI1598 - ALVKRTPSSGMSSTMKESAFQSEPRVSESLVRHASTSPADKAKVTISDGKVTDEEKPKKSSLCRTVEGC

REELQNQ - UNI4331 - ANFSFAPLVLDMLSFLMDAIQTNFQQASAVGSSSRAQQALSELHTVDKGVEMTDQLM VPTLGSQEGAFENVRMNYSGDQ

GQTIRQLISAHVLRRVAMCVLSSPHGRRQHLAVSHEKGK ITVLQLSALLKQADSSKRKLTLTRLASAPVPFTVLSLTGNPCKEDYLAVCGLK DCHVLT

FSSSGSVSDHLVLHPQLATGNFIIKAVWLPGSQTELAIVTADFVK IYDLSIDALSPTFYFLLPSSKIRDVTFLFNEEGKNIIVIMSSAGYMYTQLMEEA

SSAQQGPFYVTNVLEINHEDLK DSNSQVAGGGVSVYYSHVLQMLFFSYSQGRSFAATVSRSTLEVLQLFPINIKS SSNGGSKTSPALCQWSEVMNHPG

LVCCVQQTTGVPLVVMVKPGTFLIQEIKTLPAKAK IQDMVAIRHTACNEQQRTTMILLCEDGSLRIYMANVENTSYWLQPSLQPSSVISIMKPVRKRKT

ATIT - UNI12196 - TARTSSQVTFPIDFFEHNQQLTDVEFGGNDLLQVYNAQQIKHRLNSTGMYVANTK PGGFTIEISNNSSTMVMTGMRIQIGT

QAIERAPSYIEIFGRTMQLNLSRSRWFDFPFTREEALQADRKLSLFI - UNI11406 - IGASVDPAGVTMIDAVKIYGKTKEQFGWPDEPPEDFPSA

SVSNICPPNLNQSNGTGESDSAAPATTSGTVLER RLVVSSLEALESCFAVGPIIEK - UNI3385 - ERNKHAAQELATLLLSLPAPASVQQQSKSL

LASLHSSRSAYHSHK DQALLSKAVQCLNTSSKEGKDLDPEVFQRLVITARSIAVTRPNNLVHFTESKLPQMETE EGADEGKEPQKQEGDGCSFITQLV

NHFWKLHASKPKNAFLAPACLPG GLTHIEATVNALVDIIHGYCTCELDCINTASKIYMQMLLCP - UNI2616 - DPAVSFSCKQALIRVLRPRNKR

RHVTLPSSPRSNTPMG - UNI2616 - GDKDDDDDDDADEKMQSSGIPDGGHIRQESQEQSEVDHGDFEMV - UNI5145 - SESMVLETAENVNN

GNPSPLEALLAGAEGFPPMLDIPPDADDETMVELAIALSLQQDQQG GSSSSALGLQSLGLSGQAPSSSSLDAGTLSDTTASA - UNI6904 - APAS

DDEGSTAATDGSTLRTSPADHGGSVGSESGGSAVDSVAGEHSV - UNI6904 - VSGRSSAYGDATAEGHPAGPGSVSSSTGAISTATGHQEGDGSEG

EGEGEAEGDVHTSNR RLHMVRLMLLERLLQTLPQLRNVGGVRAIPYMQ VILMLTTDLDGEDEKDKGALDNLLAQLIAELGMDKK - UNI9067 - D

VSKKNERSALNEVHLVVMRLLSVFMSRTKSGSKSSICE - UNI9067 - SSSLISSATAAALLSSGAVDYCLHVLKSLLEYWKSQQSDEEPVAASQLL

KPHTTSSPPDMSPFFLRQYVK GHAADVFEAYTQLLTEMVLRLPYQIKKIADTSSRIPPPVFDHSWFYFLSE YLMIQQTPFVRRQVRKLLLFICGSKEK

YRQLRDLHTLDSHVRGIKKLLEEQGIFLRASVVTASSGSALQYDTLISL MEHLKACAEIAAQRTINWQKFCIKDDS - UNI29171 - SVLYFLLQV

SFLVDEGVSPVLLQLLSCALCGSKVLAALAASTGSSSVASSSAPPAASSGQATTQSKSSTKKSKKEEKEKEKEG GESSGSQEDQLCTALVNQLNRFADK

ETLIQFLRCFLLESNSSSVRWQAHCLTLHIYR RNSNKAQQELLLDLMWSIWPELPAYGRKAAQFVDLLGYFSLKTAQTEKK LKEYSQKAVEILRTQNH

ILTNHPNSNIYN NTLSGLVEFDGYYLESDPCLVCNNPEVPFC YIKLSSIKVDTRYTTTQQVVKLIGSHTISKVTVKIGDLKRTKMVRTINLYYNNRTV

QAIVELKNK KPARWHKAKKVQLTPGQTEVKIDLPLPIVASNLMIEFADFYENYQASTETLQCPRCSASVPANPGVCGNCGENVYQCHKCR RSINYDEK

DPFLCNACGFCKYARFDFMLYAKPCCAVDPIENEEDRKK AVSNINTLLDKADRVYHQLMGHRPQLENLLCKVNEAAPEKPQ EDSGTAGGISSTSASVN

RYILQLAQEYCGDCKNSFDELSKIIQ KVFASRKELLEYDLQQREAATKSSRTSVQPTFTASQYRALSVLGCGHTSSTKCYGCASAVTEHCITLLRALAT

NPALRHILVSQGLIRELFDYNLRRGAAAIREEVRQLMCLLTR RDNPEATQQMNDLIIGKVSTALKGHWANPDL ASSLQYEMLLLTDSISKEDSCWELR

LRCA ALSLFLMAVNIKTPVVVENITLMCLRILQKLIKPPAPTSKKNK DVPVEALTTVKPYCNEIHAQAQLWLKRDPKASYEAWKKCLPIRG GVDGNG

KSPSKSELHRLYLTEKYVWRWKQFLSRRGKRTTPLDLKLGHNNWLRQ VLFTPATQAARQAACTIVEALATVPSRKQQVLDLLTS SYLDELSVAGECAA

EYLALYQKLIASCHWKVYLAARGVLPYVGNLITK EIARLLALEEATLSTDLQQGYALKSLTG GLLSSFVEVESIKRHFKSRLVGTVLNGYLCLRKLVL

QRTKLIDETQDMLLEMLEDMTTG - UNI89 - GTESETKAFMAVCIETAKRYNLDDYRTPVFIFERLCSIIYP EENEVTEFFVTLEKDPQQEDFLQG

RMPGNPYSSNEPGIGPLMRDIKNKICQDCDLVALLEDDSGME LLVNNKIISLDLPVAEVYKKVWCATNE GEPMRIVYRMRGLLGDATEEFIESLDSTT

D DEEEDEEEVYRMAGVMAQCGGLQCMLNRLAGVKDFKQGRHLLT VLLKLFSYCVKVKVNRQQLVKLETNTLNVMLGTLNL ALVAEQESKDSGGAAVA

EQVLSIMEIILDESNAEPLSEDK GNLLLTGDKDQLVMLLDQINSTFVRSNPSVLQGLLRIIPYLSFGEVEKMQILVERFKPYCSFEK KYDEDHSGDDK

VFLDCFCKIAAGIKNNSNGHQLKDLILQKGITQNALDYMKKHIPSAKN NLDADIWKKFLSRPALPFILRLLRGLAMQHPATQ VLIGTDSITSLHKLEQ

VSSDEGIGTLAENLLEALREHPDVNKKIDAARRETRAEKKRMAMAMRQKALGTLGMT TNEKGQVVTKTALLKQMEELIEEPGLTCCICREGYKFQ PTK

VLGIYTFTKRVALEEMENKPRKQQGYSTVSHFNIVHYDCHLAAVR RLARGREEWESAALQNANTKCNGLLPVWGPHVPESAFATCLAR RHNTYLQECT

GQREPTYQLNIHDIKLLFLRFAMEQSFSADTGGGGRESNIHLIPYIIHTVLYVLNT - UNI6753 - TTRATSREEKNLQGFLEQPKEKWTESAFDVD

GPHYFTILALHVLPPEQWKAIRVEILRRLLVASHARAVAPGGATR - UNI17371 - RLTDKAVKDYSAYRSSLLFWALVDLIYNMFK KVPTSNTEG

GWSCSLAEYIRHNDMPIYEAADKALKTFQEEFMPVETFSEFLDAAG - UNI18868 - GLLSEITDPESFLKDLLNSVP
Transcript ENSMUST00000040670
Sequence
CCCTGGTCAGGTTGACTGGGGATCTGATTGT GTGGTCAGATGAGATGAACCCAGCACAGGTGATCCGGACTCTGTTACCGCTTCTCTTGGAGTCAAGCA

CAGAGAGCGCTGCTGAGATCAGCAGTAACTCTCTGGAGCGCATCTTGGGACCTGCGGAGTCTGATGAGTTCCTGGCTCGTGTGTATGAGAAGCTGATCAC

GGGATGTTACAACATTCTGGCCAACCATGCAGATCCCAACAG - UNI10835 - TGGGCTGGATGAGTCCATCCTGGAGGAGTGTTTACAGTATCTGG

AGAAGCAGCTGGAGAGCAGCCAGGCCCGGAAGGCCATGGAGGAGTTCTTCTCTGATGG TGGGGAGCTGGTGCAGATCATGATGGCCACAGCCAATGAGG

ACCTCTCTGCTAAATTCTGTAACCGAGTCTTGAAATTCTTCACCAAACTCTTCCAGCTGA - UNI9288 - CTGAGAAGAGCCCTAACCCGAGCCTCC

TTCACCTCTGTGGCTCTCTCGCCCAGCTTGCGTGTGTGGAGCCGGTACGCCTGCAGGCCTGGCTCACCCGCATGACAACATCGCCCCCGAAGGATTCTGA

CCAGCTGGAGGTCATTCAGGAGAACCGGCAGCTGCTGCAGTTACTGACCACGTACATCGTTCGGGAGAACAG - UNI4306 - CCAAGTTGGAGAAGG

TGTGTGTGCTGTGCTTCTGGGCACCCTGACCCCCATGGCAACAGATATGCTGGCGAACGGTGATGGGACCGGCTTCCCTGAGCTCATGGTTGTGATGGCC

ACTCTAGCCAGTGCCGGGCAAGGAGCTGGCCACCTTCAGCTTCACAATGCTGCAGTGGACTGGCTGGGCAGATG CAAGAAATACCTGTCACAGAAGAAC

GTGGTTGAGAAGCTGAATGCCAATGTAATGCATGGAAAG CATGTGATGGTCTTGGAGTGCACATGTCATATTATGTCTTACCTGGCCGATGTCACAAAT

GCCCTGAGCCAGAGTAATGGTCAAGGCCCAAGCCATCTGTCAGTGGATGGGGAAGAGCGTGCCATTGAGGTGGATTCAGACTGGGTGGAAGAGTTAGCGG

TGGAGGAGGAAGACTCCCAGGCTGAGGACTCT GATGAAGATTCTCTTTGCAATAAGCTGTGTACCTTCACCATCACACAGAAGGAGTTTATGAACCAGC

ATTG GTACCACTGTCATACCTGTAAGATGGTGGATGGGGTGGGTGTGTGCACAGTGTGTGCAAAGGTATGCCATAAGGACCATGAGATTTCCTACGCCA

AGTATGGTTCCTTTTTCTGTGACTGTGGAGCCAAGGAAGATGGCAGCTGCTTG - UNI1598 - GCCCTGGTGAAGCGAACTCCTAGCAGTGGCATGA

GCTCTACCATGAAGGAGTCAGCATTTCAGAGCGAACCTAGGGTTTCCGAAAGTCTGGTGCGCCATGCCAGCACCTCTCCTGCTGACAAGGCCAAGGTCAC

CATCAGTGATGGGAAGGTTACAGATGAAGAGAAGCCCAAGAAGAGCAGCCTGTGCCGTACAGTTGAGGGGTGTCGTGAGGAGCTGCAGAATCAG - UNI

4331 - GCCAATTTCTCCTTCGCTCCTCTCGTGTTAGACATGCTCAGTTTCCTCATGGATGCCATTCAGACCAACTTTCAGCAGGCTTCAGCCGTGGGG

AGCAGCAGCAGGGCCCAGCAGGCCCTCAGTGAACTGCACACAGTGGACAAGGGTGTGGAGATGACAGACCAGCTGATG GTTCCCACCTTAGGCTCACAG

GAAGGTGCCTTTGAGAATGTTCGGATGAATTACAGCGGAGACCAGGGCCAGACTATACGGCAGCTGATCAGTGCCCACGTGCTGAGACGGGTGGCTATGT

GTGTGCTTTCTTCCCCCCATGGGCGCCGCCAGCATTTGGCTGTTAGCCATGAGAAGGGCAAG ATCACAGTGCTGCAGCTCTCAGCGCTCCTGAAGCAAG

CAGATTCCAGTAAGAGGAAGCTGACGCTAACCCGCTTGGCTTCTGCCCCAGTTCCCTTCACAGTGCTGAGTCTTACTGGAAACCCCTGCAAGGAGGACTA

CCTGGCAGTGTGTGGGCTGAAG GACTGCCACGTGCTCACCTTCAGCAGCTCAGGCTCTGTCTCCGATCACTTAGTGTTACATCCCCAGTTGGCCACAGG

GAACTTCATCATCAAAGCTGTGTGGCTCCCTGGTTCACAGACTGAGCTAGCCATCGTCACCGCAGACTTCGTCAAG ATTTACGACCTGTCTATTGATGC

CTTGAGTCCAACCTTCTACTTCCTCCTGCCGAGCTCAAAGATAAGAGACGTTACCTTCCTTTTCAACGAGGAAGGCAAGAACATCATTGTCATCATGTCC

TCTGCTGGGTACATGTACACACAACTCATGGAGGAGGCCAGCAGTGCCCAGCAGGGCCCCTTCTATGTCACTAATGTGCTGGAAATAAATCACGAGGACC

TGAAG GACAGTAACAGCCAGGTGGCAGGCGGTGGCGTGTCTGTGTACTACTCACACGTGTTGCAGATGCTTTTCTTCAGCTACAGTCAGGGCAGGTCCT

TTGCAGCCACTGTCAGCAGGAGCACCCTGGAGGTGTTGCAGCTCTTCCCCATCAACATCAAAAG CTCCAATGGTGGCAGTAAGACTTCTCCTGCCCTTT

GCCAGTGGTCCGAGGTGATGAACCACCCTGGCTTGGTGTGTTGTGTTCAGCAGACTACTGGCGTGCCTCTGGTGGTCATGGTGAAGCCAGGCACTTTCCT

CATCCAGGAGATTAAGACTCTTCCCGCCAAAGCAAAG ATCCAAGACATGGTTGCCATTAGGCACACTGCCTGCAATGAGCAGCAACGTACAACCATGAT

CCTGCTGTGCGAGGACGGCAGCCTGCGGATTTACATGGCCAATGTAGAGAACACCTCTTACTGGCTCCAGCCGTCTCTGCAGCCCAGCAGTGTCATCAGC

ATCATGAAACCTGTGCGGAAGCGCAAAACAGCTACCATCA - UNI12196 - CAGCCCGCACATCCAGCCAGGTCACCTTCCCCATTGACTTTTTTGA

ACACAACCAGCAGCTAACAGATGTGGAGTTTGGCGGTAATGACCTCTTGCAAGTCTACAATGCACAGCAGATAAAGCACAGGCTGAACTCCACTGGCATG

TACGTGGCTAACACCAAG CCTGGCGGCTTCACCATCGAGATCAGTAACAACAGCAGCACCATGGTGATGACGGGCATGCGGATCCAGATTGGGACGCAG

GCCATCGAGCGGGCCCCGTCCTACATCGAGATCTTCGGCAGGACCATGCAGCTGAACCTGAGCCGCTCCCGCTGGTTTGACTTCCCCTTCACCAGAGAGG

AGGCCCTGCAGGCCGACCGGAAGCTGAGCCTCTTCA - UNI11406 - TCGGTGCCTCCGTGGATCCAGCTGGTGTCACCATGATAGATGCTGTAAAA

ATTTATGGCAAGACTAAAGAGCAGTTTGGCTGGCCTGATGAGCCCCCAGAAGACTTCCCTTCTGCCTCAGTCAGCAACATCTGCCCTCCTAACCTGAACC

AGAGCAATGGCACTGGAGAGAGTGACTCAGCCGCCCCTGCCACAACCAGTGGCACTGTCCTGGAGAG TTCTGAAACTGAGTCCCTAACCAAGCTGGATC

G GCTGGTTGTGAGTTCTTTGGAAGCCCTGGAAAGCTGCTTTGCTGTTGGCCCAATCATTGAGAAG - UNI3385 - GAGAGAAACAAGCATGCCGCT

CAGGAGCTAGCCACTTTGTTGCTCTCCCTGCCAGCGCCTGCCAGTGTCCAGCAGCAATCAAAGAGCCTCCTGGCCAGTCTGCACAGCAGCCGCTCGGCCT

ACCACAGCCATAAG GACCAGGCCTTGTTGAGCAAAGCTGTGCAGTGTCTCAACACATCCAGCAAAGAAGGCAAGGACTTGGACCCCGAGGTGTTCCAGC

GCCTGGTGATCACAGCTCGCTCCATTGCCGTCACACGCCCTAACAACCTTGTGCACTTCACCGAGTCAAAGCTGCCCCAGATGGAAACAG AAGGAGCAG

ATGAGGGGAAAGAGCCGCAGAAGCAGGAAGGAGACGGCTGTAGTTTCATCACTCAGCTTGTAAACCACTTCTGGAAACTCCATGCATCTAAGCCCAAGAA

TGCCTTCCTGGCACCTGCCTGCCTGCCAG GCCTTACTCATATTGAAGCTACGGTTAATGCGTTGGTAGACATTATCCACGGTTATTGTACCTGCGAGCT

GGACTGTATCAACACAGCATCCAAGATCTACATGCAGATGCTGCTGTGTCCT - UNI2616 - GACCCTGCTGTGAGCTTCTCCTGTAAACAAGCTCT

GATTCGAGTCCTAAGGCCCAGGAACAAGCGGAGACACGTGACGTTGCCCTCCTCCCCTCGAAGCAACACTCCAATGG - UNI2616 - GAGACAAGGA

CGACGATGATGACGATGACGCAGATGAGAAAATGCAGTCATCGGGCATCCCCGATGGTGGTCACATCCGCCAGGAAAGCCAGGAACAGAGTGAGGTGGAC

CATGGAGATTTTGAGATGGTG - UNI5145 - TCTGAGTCGATGGTCCTGGAAACAGCTGAAAATGTCAACAATGGCAACCCCTCTCCCCTGGAGGCC

CTGCTGGCAGGTGCTGAAGGCTTTCCTCCCATGCTGGACATCCCACCTGATGCAGACGACGAGACCATGGTTGAACTAGCCATTGCCCTGAGCCTGCAGC

AGGACCAGCAAG - UNI6904 - CTCCAGCCTCAGATGACGAGGGCAGCACTGCAGCAACTGACGGCTCCACCCTGCGGACCTCGCCAGCTGACCATG

GCGGTAGTGTGGGCTCAGAGAGCGGGGGAAGTGCAGTGGACTCGGTGGCTGGCGAGCACAGTG - UNI6904 - TGTCTGGCCGGAGCAGTGCATATG

GTGACGCCACAGCTGAGGGGCACCCGGCTGGACCAGGGAGCGTCAGCTCTAGCACAGGCGCCATCAGCACCGCCACTGGGCACCAGGAGGGAGACGGCTC

TGAGGGAGAAGGAGAAGGGGAAGCTGAAGGAGATGTGCACACTAGCAACAG GCTACACATGGTTCGTCTGATGCTGTTGGAAAGATTGCTGCAGACACT

GCCCCAGTTACGGAATGTCGGAGGTGTCCGGGCCATCCCATACATGCAG GTCATTCTCATGCTCACTACAGATCTCGATGGAGAAGATGAGAAAGACAA

GGGAGCCCTGGACAACCTGCTTGCACAGCTCATCGCCGAGTTGGGCATGGACAAAAAG - UNI9067 - GATGTCTCCAAGAAGAACGAGCGCAGTGC

TCTGAATGAAGTCCATTTGGTCGTGATGAGACTCCTGAGTGTCTTCATGTCTCGTACCAAGTCTGGATCCAAATCTTCCATCTGTGAG - UNI9067 -

 TCCTCTTCCCTCATCTCCAGTGCCACGGCAGCAGCCCTGCTTAGCTCAGGGGCTGTGGACTATTGCCTCCATGTGCTCAAGTCTCTGCTGGAATACTGG

AAGAGCCAGCAGAGTGATGAGGAGCCTGTGGCTGCCAGCCAACTGCTGAAACCACACACGACTTCATCTCCGCCAGATATGAGCCCATTCTTTCTCCGCC

AGTATGTGAAG GGCCATGCCGCTGATGTCTTTGAAGCCTATACCCAGCTGCTCACAGAGATGGTACTGAGGCTTCCCTACCAAATCAAGAAGATCGCAG

ACACCAGCTCTCGGATTCCTCCTCCTGTCTTTGATCACTCCTGGTTCTACTTCCTCTCTGAG TACCTAATGATCCAGCAGACCCCTTTTGTCCGCCGAC

AAGTTCGAAAACTTCTGCTCTTCATCTGTGGATCAAAGGAGAAATACCGACAGCTCCGAGACCTGCACACCCTGGACTCCCATGTGCGTGGGATCAAGAA

GCTGCTGGAGGAGCAGGGCATCTTCCTCCGGGCCAGTGTGGTCACAGCCAGTTCCGGCTCCGCTTTGCAGTATGACACGCTCATCAGCCTG ATGGAGCA

TCTGAAGGCCTGTGCAGAGATTGCCGCCCAGCGAACCATCAACTGGCAGAAGTTCTGCATCAAAGATGACT - UNI29171 - CTGTCCTGTACTTCC

TCCTGCAAGTGAGTTTCCTGGTAGATGAGGGGGTGTCCCCCGTGCTGCTGCAGCTGCTCTCCTGTGCTCTGTGCGGCAGCAAAGTGCTCGCAGCCCTGGC

GGCCTCCACAGGGTCTTCCAGTGTGGCTTCCTCCTCAGCCCCTCCTGCAGCCAGTTCTGGACAAGCCACAACTCAGTCCAAATCTTCCACTAAAAAGAGC

AAGAAAGAAGAAAAGGAAAAAGAGAAAGAG
Translation
LVRLTGDLIV VWSDEMNPAQVIRTLLPLLLESSTESAAEISSNSLERILGPAESDEFLARVYEKLITGCYNILANHADPNS - UNI10835 - SGLD

ESILEECLQYLEKQLESSQARKAMEEFFSDG GGELVQIMMATANEDLSAKFCNRVLKFFTKLFQLT - UNI9288 - TEKSPNPSLLHLCGSLAQLA

CVEPVRLQAWLTRMTTSPPKDSDQLEVIQENRQLLQLLTTYIVRENS - UNI4306 - SQVGEGVCAVLLGTLTPMATDMLANGDGTGFPELMVVMAT

LASAGQGAGHLQLHNAAVDWLGRC CKKYLSQKNVVEKLNANVMHGK HVMVLECTCHIMSYLADVTNALSQSNGQGPSHLSVDGEERAIEVDSDWVEEL

AVEEEDSQAEDS DEDSLCNKLCTFTITQKEFMNQHW WYHCHTCKMVDGVGVCTVCAKVCHKDHEISYAKYGSFFCDCGAKEDGSCL - UNI1598 -

 ALVKRTPSSGMSSTMKESAFQSEPRVSESLVRHASTSPADKAKVTISDGKVTDEEKPKKSSLCRTVEGCREELQNQ - UNI4331 - ANFSFAPLVL

DMLSFLMDAIQTNFQQASAVGSSSRAQQALSELHTVDKGVEMTDQLM VPTLGSQEGAFENVRMNYSGDQGQTIRQLISAHVLRRVAMCVLSSPHGRRQH

LAVSHEKGK ITVLQLSALLKQADSSKRKLTLTRLASAPVPFTVLSLTGNPCKEDYLAVCGLK DCHVLTFSSSGSVSDHLVLHPQLATGNFIIKAVWLP

GSQTELAIVTADFVK IYDLSIDALSPTFYFLLPSSKIRDVTFLFNEEGKNIIVIMSSAGYMYTQLMEEASSAQQGPFYVTNVLEINHEDLK DSNSQVA

GGGVSVYYSHVLQMLFFSYSQGRSFAATVSRSTLEVLQLFPINIKS SSNGGSKTSPALCQWSEVMNHPGLVCCVQQTTGVPLVVMVKPGTFLIQEIKTL

PAKAK IQDMVAIRHTACNEQQRTTMILLCEDGSLRIYMANVENTSYWLQPSLQPSSVISIMKPVRKRKTATIT - UNI12196 - TARTSSQVTFPI

DFFEHNQQLTDVEFGGNDLLQVYNAQQIKHRLNSTGMYVANTK PGGFTIEISNNSSTMVMTGMRIQIGTQAIERAPSYIEIFGRTMQLNLSRSRWFDFP

FTREEALQADRKLSLFI - UNI11406 - IGASVDPAGVTMIDAVKIYGKTKEQFGWPDEPPEDFPSASVSNICPPNLNQSNGTGESDSAAPATTSGT

VLES SSETESLTKLDR RLVVSSLEALESCFAVGPIIEK - UNI3385 - ERNKHAAQELATLLLSLPAPASVQQQSKSLLASLHSSRSAYHSHK D

QALLSKAVQCLNTSSKEGKDLDPEVFQRLVITARSIAVTRPNNLVHFTESKLPQMETE EGADEGKEPQKQEGDGCSFITQLVNHFWKLHASKPKNAFLA

PACLPG GLTHIEATVNALVDIIHGYCTCELDCINTASKIYMQMLLCP - UNI2616 - DPAVSFSCKQALIRVLRPRNKRRHVTLPSSPRSNTPMG 

- UNI2616 - GDKDDDDDDDADEKMQSSGIPDGGHIRQESQEQSEVDHGDFEMV - UNI5145 - SESMVLETAENVNNGNPSPLEALLAGAEGFP

PMLDIPPDADDETMVELAIALSLQQDQQA - UNI6904 - APASDDEGSTAATDGSTLRTSPADHGGSVGSESGGSAVDSVAGEHSV - UNI6904 

- VSGRSSAYGDATAEGHPAGPGSVSSSTGAISTATGHQEGDGSEGEGEGEAEGDVHTSNR RLHMVRLMLLERLLQTLPQLRNVGGVRAIPYMQ VILM

LTTDLDGEDEKDKGALDNLLAQLIAELGMDKK - UNI9067 - DVSKKNERSALNEVHLVVMRLLSVFMSRTKSGSKSSICE - UNI9067 - SSS

LISSATAAALLSSGAVDYCLHVLKSLLEYWKSQQSDEEPVAASQLLKPHTTSSPPDMSPFFLRQYVK GHAADVFEAYTQLLTEMVLRLPYQIKKIADTS

SRIPPPVFDHSWFYFLSE YLMIQQTPFVRRQVRKLLLFICGSKEKYRQLRDLHTLDSHVRGIKKLLEEQGIFLRASVVTASSGSALQYDTLISL MEHL

KACAEIAAQRTINWQKFCIKDDS - UNI29171 - SVLYFLLQVSFLVDEGVSPVLLQLLSCALCGSKVLAALAASTGSSSVASSSAPPAASSGQATT

QSKSSTKKSKKEEKEKEKE
Transcript ENSMUST00000064355
Sequence
GACCAGGCCTTGTTGAGCAAAGCTGTGCAGTGTCTCAACACATCCAGCAAAGAAGGCAAGGACTTGGACCCCGAGGTGTTCCAGCGCCTGGTGATCACAG

CTCGCTCCATTGCCGTCACACGCCCTAACAACCTTGTGCACTTCACCGAGTCAAAGCTGCCCCAGATGGAAACAG ACTGTTTTTCTCCCAGATGTGCCT

GCTGGAATCTAGGGATAGTTGGCATATTGATTGGGGCCCCACTTGAAACTCCCTCCGCAG AAGGAGCAGATGAGGGGAAAGAGCCGCAGAAGCAGGAAG

GAGACGGCTGTAGTTTCATCACTCAGCTTGTAAACCACTTCTGGAAACTCCATGCATCTAAGCCCAAGAATGCCTTCCTGGCACCTGCCTGCCTGCCAG 

GCCTTACTCATATTGAAGCTACGGTTAATGCGTTGGTAGACATTATCCACGGTTATTGTACCTGCGAGCTGGACTGTATCAACACAGCATCCAAGATCTA

CATGCAGATGCTGCTGTGTCCT - UNI2616 - GACCCTGCTGTGAGCTTCTCCTGTAAACAAGCTCTGATTCGAGTCCTAAGGCCCAGGAACAAGCG

GAGACACGTGACGTTGCCCTCCTCCCCTCGAAGCAACACTCCAATGG - UNI2616 - GAGACAAGGACGACGATGATGACGATGACGCAGATGAGAA

AATGCAGTCATCGGGCATCCCCGATGGTGGTCACATCCGCCAGGAAAGCCAGGAACAGAGTGAGGTGGACCATGGAGATTTTGAGATGGTG - UNI514

5 - TCTGAGTCGATGGTCCTGGAAACAGCTGAAAATGTCAACAATGGCAACCCCTCTCCCCTGGAGGCCCTGCTGGCAGGTGCTGAAGGCTTTCCTCCC

ATGCTGGACATCCCACCTGATGCAGACGACGAGACCATGGTTGAACTAGCCATTGCCCTGAGCCTGCAGCAGGACCAGCAAG GCAGCAGCAGCAGTGCC

CTGGGCCTGCAGAGCCTGGGACTCTCCGGCCAGGCACCCAGCTCTTCCTCTCTGGACGCAGGAACCCTCTCTGACACCACAGCATCAG - UNI6904 -

 CTCCAGCCTCAGATGACGAGGGCAGCACTGCAGCAACTGACGGCTCCACCCTGCGGACCTCGCCAGCTGACCATGGCGGTAGTGTGGGCTCAGAGAGCG

GGGGAAGTGCAGTGGACTCGGTGGCTGGCGAGCACAGTG - UNI6904 - TGTCTGGCCGGAGCAGTGCATATGGTGACGCCACAGCTGAGGGGCACC

CGGCTGGACCAGGGAGCGTCAGCTCTAGCACAGGCGCCATCAGCACCGCCACTGGGCACCAGGAGGGAGACGGCTCTGAGGGAGAAGGAGAAGGGGAAGC

TGAAGGAGATGTGCACACTAGCAACAG GCTACACATGGTTCGTCTGATGCTGTTGGAAAGATTGCTGCAGACACTGCCCCAGTTACGGAATGTCGGAGG

TGTCCGGGCCATCCCATACATGCAG GTCATTCTCATGCTCACTACAGATCTCGATGGAGAAGATGAGAAAGACAAGGGAGCCCTGGACAACCTGCTTGC

ACAGCTCATCGCCGAGTTGGGCATGGACAAAAAG - UNI9067 - GATGTCTCCAAGAAGAACGAGCGCAGTGCTCTGAATGAAGTCCATTTGGTCGT

GATGAGACTCCTGAGTGTCTTCATGTCTCGTACCAAGTCTGGATCCAAATCTTCCATCTGTGAG - UNI9067 - TCCTCTTCCCTCATCTCCAGTGC

CACGGCAGCAGCCCTGCTTAGCTCAGGGGCTGTGGACTATTGCCTCCATGTGCTCAAGTCTCTGCTGGAATACTGGAAGAGCCAGCAGAGTGATGAGGAG

CCTGTGGCTGCCAGCCAACTGCTGAAACCACACACGACTTCATCTCCGCCAGATATGAGCCCATTCTTTCTCCGCCAGTATGTGAAG GGCCATGCCGCT

GATGTCTTTGAAGCCTATACCCAGCTGCTCACAGAGATGGTACTGAGGCTTCCCTACCAAATCAAGAAGATCGCAGACACCAGCTCTCGGATTCCTCCTC

CTGTCTTTGATCACTCCTGGTTCTACTTCCTCTCTGAG TACCTAATGATCCAGCAGACCCCTTTTGTCCGCCGACAAGTTCGAAAACTTCTGCTCTTCA

TCTGTGGATCAAAGGAGAAATACCGACAGCTCCGAGACCTGCACACCCTGGACTCCCATGTGCGTGGGATCAAGAAGCTGCTGGAGGAGCAGGGCATCTT

CCTCCGGGCCAGTGTGGTCACAGCCAGTTCCGGCTCCGCTTTGCAGTATGACACGCTCATCAGCCTG ATGGAGCATCTGAAGGCCTGTGCAGAGATTGC

CGCCCAGCGAACCATCAACTGGCAGAAGTTCTGCATCAAAGATGACT - UNI29171 - CTGTCCTGTACTTCCTCCTGCAAGTGAGTTTCCTGGTAG

ATGAGGGGGTGTCCCCCGTGCTGCTGCAGCTGCTCTCCTGTGCTCTGTGCGGCAGCAAAGTGCTCGCAGCCCTGGCGGCCTCCACAGGGTCTTCCAGTGT

GGCTTCCTCCTCAGCCCCTCCTGCAGCCAGTTCTGGACAAGCCACAACTCAGTCCAAATCTTCCACT
Translation
DQALLSKAVQCLNTSSKEGKDLDPEVFQRLVITARSIAVTRPNNLVHFTESKLPQMETD DCFSPRCACWNLGIVGILIGAPLETPSAE EGADEGKEPQ

KQEGDGCSFITQLVNHFWKLHASKPKNAFLAPACLPG GLTHIEATVNALVDIIHGYCTCELDCINTASKIYMQMLLCP - UNI2616 - DPAVSFSC

KQALIRVLRPRNKRRHVTLPSSP - UNI2616 -  - UNI5145 -   - UNI6904 -  - UNI6904 -    - UNI9067 -  - UNI906

7 -     - UNI29171 - 

For any suggestions or comments, please send an email to unitrap@crg.es