Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000066150 (Slc31a1)
Chromosomal location
Chr 4: 62021754 - 62052803 (+)
Description
solute carrier family 31, member 1 Gene [Source:MGI (curated);Acc:Slc31a1-001]
RefSeq_dna
NM_175090 
RefSeq_peptide
NP_780299.1 
UniGene
Mm.248637 Mm.466981 
MGI
MGI:1333843 
Uniprot/SWISSPROT
Q8K211 
Uniprot/SPTREMBL
A8Y5P1 Q3TDB6 
Human Ortholog
ENSG00000136868 (SLC31A1)
Omim not available
UniTrap UNI18859
Vector Insertion
Chr 4: 62021878 - 62046525
Public Clones (sanger) E058G07 (ggtc) IST14225D5 (tigm)
Private Clones OST412877 (lexicon) OST394007 (lexicon) OST368353 (lexicon) OST318943 (lexicon)
OST316565 (lexicon) OST308253 (lexicon) OST278181 (lexicon) OST275809 (lexicon)
OST271288 (lexicon) OST271083 (lexicon) OST269325 (lexicon) OST260855 (lexicon)
OST252084 (lexicon) OST250805 (lexicon) OST249891 (lexicon) OST239361 (lexicon)
OST237398 (lexicon) OST237397 (lexicon) OST225155 (lexicon) OST207790 (lexicon)
OST207599 (lexicon) OST206910 (lexicon) OST206892 (lexicon) OST200832 (lexicon)
OST191833 (lexicon) OST141847 (lexicon) OST116500 (lexicon) OST113956 (lexicon)
OST96832 (lexicon) OST54551 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20949
Vector Insertion
Chr 4: 62046713 - 62047124
Public Clones not available
Private Clones OST347592 (lexicon) OST303635 (lexicon) OST293197 (lexicon) OST225048 (lexicon)
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21987
Vector Insertion
Chr 4: 62047198 - 62048900
Public Clones not available
Private Clones OST312050 (lexicon)
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2162
Vector Insertion
Chr 4: 62048900 - 62052803
Public Clones XT0365 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23298
Vector Insertion
Chr 4: 62049070 - 62049631
Public Clones not available
Private Clones OST266452 (lexicon)
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000122092
Sequence
CTGAATCTCATCTTTTTCTGGAAAACTGGCAATGAACCATATGGGGATGAACCATATGGAGATGCACCACCATATGGGTATGAACCACACGGACGACAAC

ATTACCATGCCACCTCACCACCACCCGACCACCTCAGCCTCACACTCCCACGGTGGAGGGGACAGCATGATGATGATG - UNI20949 - CCTATGAC

CTTCTACTTTGACTTTAAGAATGTGAATCTATTGTTTTCCGGTTTGGTAATCAATACACCTGGAG - UNI2162 - - UNI21987 - AAATGGCTG

GAGCCTTCGTGGCAGTGTTTTTACTAGCAATGTTTTATGAAGGACTCAAGATAGCCCGAGAGGGTCTGCTTCGAAAGTCTCAAGTCAGCATTCGCTACAA

TTCCATGCCTGTCCCAGGACCAAATGGAACCATCCTAATGGAGACACACAAAACTGTTGGGTAAGAAGATGCAACAGATCCAAAGGGAAATTCTAGAGAT

CTCTTAGTAATGTAGTAAGGCAGGCCTTCTTCTTCCGGAGTTGGTGATTCTAACTTTAGAAGTTCCAGGTTGTGGGCTATGGTATTTGGGATCCTGCAAA

AGCACATACACGTTTGTTCTATGTTGTAAGTGTCACTCTGAAAGAAGTTTAACAGTATCTGGTTTTTAAAATATTTGCTATGTAGTAATGGGCATTTTAA

GATATAGTTAAGATATAAAAGAATGGCAGAATGCGATTGATTCCTTCCTGTCGAGTTAAATCTAATCAGATATGATGGATGCCGGTAGTCCCAGCACTTG

GAGAAGGCTGGAGGACCAGAATTCAAGGCTATCCTTGGCTACACAGTGAATTTGAGACCAGCTTGGGCTCATGAGACCCTGTCTCAAGGAAAAATCAAAA

GTTCTTTACAGATGTGTGCGTGCGGGCGTCAGTTTCCAGGATAGCCGTGCTGCAGTCCAGTTAGGCTGTTCTCCTGAGCTGCAGGTGCCCAGGTCTGACT

CTCCTTCTCTGCTTATCCCCAGGCAGCAGATGCTGAGCTTCCCCCACCTCCTGCAGACAGTGCTGCACATCATCCAGGTAGTCATCAGCTACTTCCTCAT

GCTCATCTTCATGACCTACAATGGGTACCTATGCATTGCAGTAGCAGCAGGGGCTGGGACGGGATACTTTCTCTTCAGCTGGAAGAAGGCAGTGGTGGTG

GACATCACAGAGCACTGCCATTGATATCAGACTCCACATATGGCCTTATTAATTGCTGTAGGAAGCATCTTGGGACTGGAAGATATGATTCCCTTTCCAA

TCATCCCTTCTCTCTCCTGTCTATACATACACACCTACTGAATAGAAGCCTAGCTGACAGTCTCTGAATAGTGGTTTTTCTAATAAGATGAGATTTTTTT

CTCTTGGGAAGTCACCTGTGAGATGTCTTCTCCCTCATCATCCTGAGCCTTATCTAATCCAGGTAGCTTCCTAGTTAAAGACTTGGTTATCTGCTTCTTT

TTACTTCTCCAGGTTTTGATTTGTTTTGTTTTGTTTTATTTGCGGGGGGAGTGGGATACATTTTGTTTTAAACAGATATGTGTATTTGATAGGTGGGATT

CTGGGTCAGTGATAAAAAAGGATTGTAACAGGATTGATGGCACTTAGGGACATCTCATCCAACCGGGACTTAAATTTCACACTAGAAATGAGCTCCAGTC

TTAACTCAGTGAATGGGAAACACATGTTCCTCTCTCCAGGTTACACTGAAACCTGTGTAGTGTGTACAGAGTGGGTAGGGACTAAACACAGGCCTAGCGT

CTATGAGTCTGTATTCCTGCTCAGTCATCAACTTGTGTTCCTATTGAACATTTGATCAGAATGAACTTGCCAATCAAAACAAAAACAGGACAATCAATTT

AAGACAACAGAAATAGAGATTGTTAAATAAAACCATTAGTATTTTACTTTGACTCAGTACCTTGGTTTGTCCCAACTGAATAAGAGTTTGTATTGTGTGT

GTGTTCCTTGAAACCAATGATTTTCAAACTTTACAGCTTCAGAATCACCCAGAGGGCTTGTTAAGACACTACTTGGTGGACCTCAACCCCAGAACCACCA

AATTTGGCATTTCTAAGTTCCTAGGTGATGTTCTACTCACAGTCAGTCCAGAGGATTACCTTAAGAGTCTCTGCATTAAACTAGAAAAGTTGCACCTAGA

AGGGACAGAGGGTGGGGCTACCTGCTATCAGGCATGAACATGTGAATTGCTGGTTAGTAGGTGGTATGCCTTGGGCACATGTCACATCTAAATGCTGCTG

GTCGATACTTTATCATTCCACAAACATTTATTCACTTCCAAATATGTTTTATGTATACCCACATACAGTGTGTGGGATTACAGCCAAAGTATACTTGTCA

ACATATACGAAGTCTCTAGTCCTAACTTTTAAAGATCTAAGGTTCCTTGGAAGTTATTTGAAGGCCAAGAGACCTTTGCTCTGCTGTGTGAGTCAGCCAG

TCAAAAGCCCAGAAAGGCAAAAACCCAGCTTTCTTGTTTGGAGAGACATGGGGCATGTGTCTGCCAATAGCCAGTTGTTCTCAGTGTGCACTATGTAGGT

CCCCATCCACTACTTGACCACCTTTATCATTTACGGGGATTTACATAGATTACAGTGGCCAAGACCCCTTTCTCAATGAAGGATCTCATTGGACGTCCTG

TCAATCATTAATCTACATGCAGGCTTGTTCCCACACTACCTCTTTAAAGCGATTCTTCCTATGCTGGTCTGTTCAATCCTGCCCTCTTTGGTGCTAGATC

CAGTTGTGCCTCAGAGCAGAAGAAACAAACCTGCTGTCTTGTTGGCCCAGTGTTTCAGTTTTGAAGTGTGTACTTTCTCCTCTGTGTGTGCCAATTACAT

ATTAGAGAACAAGGAATGTGTACTTTGGTGGCTTTGAACCAAGAAAAGGTTTTAAGCCTACTGGATGGAGTCTAAAATTCTTAGAAATCAACTTTAGAGC

TTTGCTTTTCTCTGAGTTCATCCTGCAGTGAATGACAGGTACTGACAGCCCAACATTAAGGTGCAAATAGCCTGTTTGTCATATCAGAAGCCATGGAATA

ATAAACCCAGGGGAATCCAGAAACCACACTTAGTGGTAACCCTGGTGCTCTCTAGAATCTCCAAATGAGCTGCTATAAAACACCTTTCAGGGGCTGAGAT

GCAGCTCTGGTGTGAGTCACTTACCTAGCTTATGTCAGGCCCCTAAAAGTAATGCATAAACTGTCAGAATCGGGACCTTATCGTTGAGGTGAAAAGAACC

AAGGCCCGTAGGAACAAGGTGCTATGAATCTGAAACCAAGAGAAACCTCAGTTTGGCATGGTTCTTCAGGGTAGCTTCCGAGTAGAAATAGTCTGCTGCA

AATCCTAAACTTAAGATCCCTGCGCTAGGTTGCTAGAGACTGCGGTTAGTGCAGAACAGAGGTAAGCCTAAGTCCCATCCTCATGAACTTCAATGCCCAG

CCTTTGTGTTTATTTTATCTAAATGTCTCCTTTCATCTGTGGGAAAGCTATAGCTGAGTGTCTTTAGCCCCTGCCCTACTTTTCCCTCTCTGACTTTTTT

CCCAGGTAGCTTAGTGTTTAACATCTCTCTCACCATCCTGATGCAGTAGCATGGCTATTGCTGAGGTTATTTTACCTAATAATTAGAACTTTGTATTTAC

AAAGCAAGTAGAGGTCTTAAATTTGCTTCAAGAAGCAGTTGCTCCACTGGAATTTCTATAAAGCTGGGTAAAGGGTTAGCAGAATTACAGATCTTAAGTA

CTAACTGCAGTCCAAGATGGAAGAGTACTCAGCAGCCACTGCCCTCATCAGGAACCTCCTCGGCATCCATCAGTCTCCTCACTGCTCCTGTGCGCAGGGC

TGTCCCTCCCACACTCCCTTCCAGGCCGTGGCCTTCGCTTCCTCATTAGAATCAGGAGAGTGAGGCACAGTGTCCATCATGCCATTTAATCTTGTGCCTG

CCCTTTCCAGCCTCTTCAAAAGATGCATCCAAACAACAGGTCTGCATTTGATGTAATGCCTTAATTACTGGGGCCACATTCACGTTGACTGTCTCAGAGA

CTGTAAGCTCCCGGAGAGCAGGGTTGCTGTAATGGGAATGTTTAAGTGTTGTGTGCAAGAAAACAAAATAAATATTTTGATTTTCGTGATTCTA
Translation
MNHMGMNHMEMHHHMGMNHTDDNITMPPHHHPTTSASHSHGGGDSMMMM - UNI20949 - PMTFYFDFKNVNLLFSGLVINTPGE - UNI2162 -

 - UNI21987 - EMAGAFVAVFLLAMFYEGLKIAREGLLRKSQVSIRYNSMPVPGPNGTILMETHKTVG
Transcript ENSMUST00000084526
Sequence
TTTACTGCGGTCGTGGGACACGTCGAGCCGGGCAGTAGTGGCGGGGGCTTGGTAGAAGTCCGTACCGGACTAGGGGATCCAGTTCTGAGAGGAAGACTAA

GGCGGCGGGGCTTACCCTGTGAAG - UNI18859 - ACTTTTCCACTGAATCTCATCTTTTTCTGGAAAACTGGCAATGAACCATATGGGGATGAACC

ATATGGAGATGCACCACCATATGGGTATGAACCACACGGACGACAACATTACCATGCCACCTCACCACCACCCGACCACCTCAGCCTCACACTCCCACGG

TGGAGGGGACAGCATGATGATGATG - UNI20949 - CCTATGACCTTCTACTTTGACTTTAAGAATGTGAATCTATTGTTTTCCGGTTTGGTAATCA

ATACACCTGGAG - UNI2162 - - UNI21987 - AAATGGCTGGAGCCTTCGTGGCAGTGTTTTTACTAGCAATGTTTTATGAAGGACTCAAGATA

GCCCGAGAGGGTCTGCTTCGAAAGTCTCAAGTCAGCATTCGCTACAATTCCATGCCTGTCCCAGGACCAAATGGAACCATCCTAATGGAGACACACAAAA

CTGTTGG - UNI2162 - - UNI23298 - GCAGCAGATGCTGAGCTTCCCCCACCTCCTGCAGACAGTGCTGCACATCATCCAGGTAGTCATCAGC

TACTTCCTCATGCTCATCTTCATGACCTACAATGGGTACCTATGCATTGCAGTAGCAGCAGGGGCTGGGACGGGATACTTTCTCTTCAGCTGGAAGAAGG

CAGTGGTGGTGGACATCACAGAGCACTGCCATTGATATCAGACTCCACATATGGCCTTATTAATTGCTGTAGGAAGCATCTTGGGACTGGAAGATATGAT

TCCCTTTCCAATCATCCCTTCTCTCTCCTGTCTATACATACACACCTACTGAATAGAAGCCTAGCTGACAGTCTCTGAATAGTGGTTTTTCTAATAAGAT

GAGATTTTTTTCTCTTGGGAAGTCACCTGTGAGATGTCTTCTCCCTCATCATCCTGAGCCTTATCTAATCCAGGTAGCTTCCTAGTTAAAGACTTGGTTA

TCTGCTTCTTTTTACTTCTCCAGGTTTTGATTTGTTTTGTTTTGTTTTATTTGCGGGGGGAGTGGGATACATTTTGTTTTAAACAGATATGTGTATTTGA

TAGGTGGGATTCTGGGTCAGTGATAAAAAAGGATTGTAACAGGATTGATGGCACTTAGGGACATCTCATCCAACCGGGACTTAAATTTCACACTAGAAAT

GAGCTCCAGTCTTAACTCAGTGAATGGGAAACACATGTTCCTCTCTCCAGGTTACACTGAAACCTGTGTAGTGTGTACAGAGTGGGTAGGGACTAAACAC

AGGCCTAGCGTCTATGAGTCTGTATTCCTGCTCAGTCATCAACTTGTGTTCCTATTGAACATTTGATCAGAATGAACTTGCCAATCAAAACAAAAACAGG

ACAATCAATTTAAGACAACAGAAATAGAGATTGTTAAATAAAACCATTAGTATTTTACTTTGACTCAGTACCTTGGTTTGTCCCAACTGAATAAGAGTTT

GTATTGTGTGTGTGTTCCTTGAAACCAATGATTTTCAAACTTTACAGCTTCAGAATCACCCAGAGGGCTTGTTAAGACACTACTTGGTGGACCTCAACCC

CAGAACCACCAAATTTGGCATTTCTAAGTTCCTAGGTGATGTTCTACTCACAGTCAGTCCAGAGGATTACCTTAAGAGTCTCTGCATTAAACTAGAAAAG

TTGCACCTAGAAGGGACAGAGGGTGGGGCTACCTGCTATCAGGCATGAACATGTGAATTGCTGGTTAGTAGGTGGTATGCCTTGGGCACATGTCACATCT

AAATGCTGCTGGTCGATACTTTATCATTCCACAAACATTTATTCACTTCCAAATATGTTTTATGTATACCCACATACAGTGTGTGGGATTACAGCCAAAG

TATACTTGTCAACATATACGAAGTCTCTAGTCCTAACTTTTAAAGATCTAAGGTTCCTTGGAAGTTATTTGAAGGCCAAGAGACCTTTGCTCTGCTGTGT

GAGTCAGCCAGTCAAAAGCCCAGAAAGGCAAAAACCCAGCTTTCTTGTTTGGAGAGACATGGGGCATGTGTCTGCCAATAGCCAGTTGTTCTCAGTGTGC

ACTATGTAGGTCCCCATCCACTACTTGACCACCTTTATCATTTACGGGGATTTACATAGATTACAGTGGCCAAGACCCCTTTCTCAATGAAGGATCTCAT

TGGACGTCCTGTCAATCATTAATCTACATGCAGGCTTGTTCCCACACTACCTCTTTAAAGCGATTCTTCCTATGCTGGTCTGTTCAATCCTGCCCTCTTT

GGTGCTAGATCCAGTTGTGCCTCAGAGCAGAAGAAACAAACCTGCTGTCTTGTTGGCCCAGTGTTTCAGTTTTGAAGTGTGTACTTTCTCCTCTGTGTGT

GCCAATTACATATTAGAGAACAAGGAATGTGTACTTTGGTGGCTTTGAACCAAGAAAAGGTTTTAAGCCTACTGGATGGAGTCTAAAATTCTTAGAAATC

AACTTTAGAGCTTTGCTTTTCTCTGAGTTCATCCTGCAGTGAATGACAGGTACTGACAGCCCAACATTAAGGTGCAAATAGCCTGTTTGTCATATCAGAA

GCCATGGAATAATAAACCCAGGGGAATCCAGAAACCACACTTAGTGGTAACCCTGGTGCTCTCTAGAATCTCCAAATGAGCTGCTATAAAACACCTTTCA

GGGGCTGAGATGCAGCTCTGGTGTGAGTCACTTACCTAGCTTATGTCAGGCCCCTAAAAGTAATGCATAAACTGTCAGAATCGGGACCTTATCGTTGAGG

TGAAAAGAACCAAGGCCCGTAGGAACAAGGTGCTATGAATCTGAAACCAAGAGAAACCTCAGTTTGGCATGGTTCTTCAGGGTAGCTTCCGAGTAGAAAT

AGTCTGCTGCAAATCCTAAACTTAAGATCCCTGCGCTAGGTTGCTAGAGACTGCGGTTAGTGCAGAACAGAGGTAAGCCTAAGTCCCATCCTCATGAACT

TCAATGCCCAGCCTTTGTGTTTATTTTATCTAAATGTCTCCTTTCATCTGTGGGAAAGCTATAGCTGAGTGTCTTTAGCCCCTGCCCTACTTTTCCCTCT

CTGACTTTTTTCCCAGGTAGCTTAGTGTTTAACATCTCTCTCACCATCCTGATGCAGTAGCATGGCTATTGCTGAGGTTATTTTACCTAATAATTAGAAC

TTTGTATTTACAAAGCAAGTAGAGGTCTTAAATTTGCTTCAAGAAGCAGTTGCTCCACTGGAATTTCTATAAAGCTGGGTAAAGGGTTAGCAGAATTACA

GATCTTAAGTACTAACTGCAGTCCAAGATGGAAGAGTACTCAGCAGCCACTGCCCTCATCAGGAACCTCCTCGGCATCCATCAGTCTCCTCACTGCTCCT

GTGCGCAGGGCTGTCCCTCCCACACTCCCTTCCAGGCCGTGGCCTTCGCTTCCTCATTAGAATCAGGAGAGTGAGGCACAGTGTCCATCATGCCATTTAA

TCTTGTGCCTGCCCTTTCCAGCCTCTTCAAAAGATGCATCCAAACAACAGGTCTGCATTTGATGTAATGCCTTAATTACTGGGGCCACATTCACGTTGAC

TGTCTCAGAGACTGTAAGCTCCCGGAGAGCAGGGTTGCTGTAATGGGAATGTTTAAGTGTTGTGTGCAAGAAAACAAAATAAATATTTTGATTTTCGTGA

TTCT
Translation
 - UNI18859 - MNHMGMNHMEMHHHMGMNHTDDNITMPPHHHPTTSASHSHGGGDSMMMM - UNI20949 - PMTFYFDFKNVNLLFSGLVINTP

GE - UNI2162 - - UNI21987 - EMAGAFVAVFLLAMFYEGLKIAREGLLRKSQVSIRYNSMPVPGPNGTILMETHKTVG - UNI2162 - - 

UNI23298 - GQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVVDITEHCH

For any suggestions or comments, please send an email to unitrap@crg.es