Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000066151 (Fkbp15)
Chromosomal location
Chr 4: 61961377 - 62021582 (-)
Description
FK506 binding protein 15 Gene [Source:MGI (curated);Acc:Fkbp15-003]
MGI
MGI:2444782 
Uniprot/SWISSPROT
Q6P9Q6 
Uniprot/SPTREMBL
Q80YW6 Q80YW7 Q80YW9 B2RQ18 
Human Ortholog
ENSG00000119321 (FKBP15)
Omim not available
UniTrap UNI28066
Vector Insertion
Chr 4: 62013580 - 62021403
Public Clones not available
Private Clones OST41018 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1680
Vector Insertion
Chr 4: 62007176 - 62013466
Public Clones CG0814 (sanger) CSH734 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4727
Vector Insertion
Chr 4: 61982096 - 61983216
Public Clones XQ0417 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38267
Vector Insertion
Chr 4: 61975287 - 61980033
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7500
Vector Insertion
Chr 4: 61969128 - 61972305
Public Clones RRR057 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107461
Sequence
GTTTGTCCTGCCGGAAAGCAGCTCGCCGCCACGGCGTTTTACGTTACCGGCGGTGACAGGCCCTGGGAACATCCAACTTCCTCCTCCCTTCAGCTGGGCG

AAAGCCGACGTGATGTTCGGTGCCGGAGACGAGGATGACACCGACTTCCTCTCGCCAAGCGGCGG - UNI28066 - AGCTAAGCTGGCTTCTCTTTT

TGGACTGGATCAAGCAACTATGGGCCATGGAAATGAATTCTTCCAGTACACAGCCCCAAAGCAACCTAAGAAAGGCCAGGGAACAGCAGCAG - UNI16

80 - GAAATCAGACAGCACCAAAGCCAGCCCCAGCTACCACAGGCACGTCCTCAGTGCTGTTTGCCACTGCAGTGCATGCATACCGCTA CATAAATGG

TCAATATGCAAAGCAGGGCAAATTTGGAGCGGCTGTCCTGGGGAACCACACAAGCAGAGAG TATAGGATTCTTCTTTACATCAGTCAGCAGCAGCCAGT

GACTGTTGCTACAATTCATCTGAACTTTGAGCTAATG GTTCGGCCCAATAACTACAGCACCTTTTATGATGACCAGAGACAAAACTGGTCTATCATGTT

TGAGTCAGAGAAGGCCGCTGTGTCATTCAATAAACAG GTGTGTGTGGCCAAGTGCAATAGCATCTCTTCCTTGGATGCAGTGCTGTGTCAGGACCTGGT

TGCAGCAGAGGGCCCTGCTGTGGAAACTGGAGATTCTTTAGAAGTAGCCTATACGGGCTGGCTCCTTCAGAATCATGTGCTGGGCCAG GTTTTTGATTC

TACTGCTAACAAAGATAAGCCGCTTCGCCTAAAATTAGGATCAGGAAAAGTTGTCAAG GGCTTAGAGGACGGGCTACTGGGCATGAAGAAAGGAGGAAA

GCGCTTAATTATCACTCCTTCAGCCTGCGCTGCTGGCTCTGAAGGAGTAATAGGCTGGACTCAGCCAACAGACTCCATCCTGGTGTTTGAGGTAGAAGTT

AGGCGG GTGAAGTTTGCCAGAGATTCTGGCTCTGATGGCCACAGTGTGAGCTCCCGGGATTCTGCAGCCCCTTCCCCCATCCCTGCTTCTGACAGCCTC

TCTGCTGATCCTGTTGTGACACCCCTGCCATTGCCTCTCAAACCTGG GGAACCGGGTCTTCGTTCCAAATCTAACTCTCTCAGCGAACAGCTAACTGTA

AATTCA AATCCTGATACGGTCAAGGCCAAGCTGATCTCGAGGATGGCTAAAATGGGCCAGCCCATGCTACCCATCCTTCCGCCACAGCTGGACTCCAAT

GACTCAGAAACCGAA GATGCAACTGTTCTGCGAGGAGCTGGGCAGTCCCTTGTGACACCATCTATCCAGCCTTCTCTTCAGCCAGCTCATCCGGTATTA

CCACAGATGGCCTCACAGG CACCTCAGCCATCTGGTTCTGGGCTCCAGACACCCTCTGCTGCCTTGATGCAAGCTGTGTCCCTTGATTCTCACTCGGCT

GTATCTGGAAATGCACAGAACTTCCAG CCCTATGCAGGTGTGCAAGCCTATGCATATCCCCAGACACCCTCAGTTACTTCCCAGCTGCAGCCTGTTCGG

CCCTTGTACCCAGCACCACTGTCCCAGGCTCCCCACTTTCAAG GATCAGGAGACATGATGTCCTTTCTCATGACTGAAGCCCGGCAACACAACACTGAA

ATTCGAATGGCAGTCAACAAAGTGGCTGATAAAATGGATCACCTCATGACTAAG GTGGAGGAGTTACAGAAGCATAGCTCTGGCAACTCCATGCTTCTT

CCTAGCATGTCGGTCACAATGGAAACAAGCATGATTATGAGCAACATCCAGCGCATCATCCAG GAAAATGAGAGACTGAAGCAGGAGCTCCTTGAGAAA

AGCAGTCGGATAGAAGAGCAGAATGACAAGATTAGTGACCTCATTGAACGCAACCAGAG - UNI4727 - ATATGTTGAGCAGAGTAACCTGATGATG

GAGAAGAGGAACAACTCGCTTCAAACAGCCACAGAAAACACACAGGCAAGAATATTGCATGCTGAACAAGAGAAGGTAAAAATCACTGGGCCGAGGAAGG

CCCATGTCGGGATGCATTGAGGTGTGGAATAGTCCTACAAAAGAACTTCCCAGTTTCTGTGCAGCAGGATATTTGCCATCTTTGGGAAGAGACCTGGAAA

TCCTTCAACAGATTTTCATGTATTAATTACCTCTAGATCTGTTTTACTAAATGTTCTACAATAAGTTGACTCAAAAACAATGATTGAATTAGGGGTACTG

TTTCATGCCTGTAACCCCAGGTTCTCACAGGCAGATGTGGGCGAATCTGTAGTTCAACAGCAGCCTTGGCTACATAGTAAGATCCTTTCTTT
Translation
MFGAGDEDDTDFLSPSGG - UNI28066 - GAKLASLFGLDQATMGHGNEFFQYTAPKQPKKGQGTAAG - UNI1680 - GNQTAPKPAPATTGTS

SVLFATAVHAYRY YINGQYAKQGKFGAAVLGNHTSRE YRILLYISQQQPVTVATIHLNFELM VRPNNYSTFYDDQRQNWSIMFESEKAAVSFNKQ V

CVAKCNSISSLDAVLCQDLVAAEGPAVETGDSLEVAYTGWLLQNHVLGQ VFDSTANKDKPLRLKLGSGKVVK GLEDGLLGMKKGGKRLIITPSACAAG

SEGVIGWTQPTDSILVFEVEVRR VKFARDSGSDGHSVSSRDSAAPSPIPASDSLSADPVVTPLPLPLKPG GEPGLRSKSNSLSEQLTVNS NPDTVKA

KLISRMAKMGQPMLPILPPQLDSNDSETE DATVLRGAGQSLVTPSIQPSLQPAHPVLPQMASQA APQPSGSGLQTPSAALMQAVSLDSHSAVSGNAQN

FQ PYAGVQAYAYPQTPSVTSQLQPVRPLYPAPLSQAPHFQG GSGDMMSFLMTEARQHNTEIRMAVNKVADKMDHLMTK VEELQKHSSGNSMLLPSMS

VTMETSMIMSNIQRIIQ ENERLKQELLEKSSRIEEQNDKISDLIERNQR - UNI4727 - RYVEQSNLMMEKRNNSLQTATENTQARILHAEQEKVK

ITGPRKAHVGMH
Transcript ENSMUST00000098033
Sequence
CCAACTTCCTCCTCCCTTCAGCTGGGCGAAAGCCGACGTGATGTTCGGTGCCGGAGACGAGGATGACACCGACTTCCTCTCGCCAAGCGGCGG - UNI2

8066 - AGCTAAGCTGGCTTCTCTTTTTGGACTGGATCAAGCAACTATGGGCCATGGAAATGAATTCTTCCAGTACACAGCCCCAAAGCAACCTAAGAA

AGGCCAGGGAACAGCAGCAG - UNI1680 - GAAATCAGACAGCACCAAAGCCAGCCCCAGCTACCACAGGCACGTCCTCAGTGCTGTTTGCCACTGC

AGTGCATGCATACCGCTA CATAAATGGTCAATATGCAAAGCAGGGCAAATTTGGAGCGGCTGTCCTGGGGAACCACACAAGCAGAGAG TATAGGATTC

TTCTTTACATCAGTCAGCAGCAGCCAGTGACTGTTGCTACAATTCATCTGAACTTTGAGCTAATG GTTCGGCCCAATAACTACAGCACCTTTTATGATG

ACCAGAGACAAAACTGGTCTATCATGTTTGAGTCAGAGAAGGCCGCTGTGTCATTCAATAAACAG GTGTGTGTGGCCAAGTGCAATAGCATCTCTTCCT

TGGATGCAGTGCTGTGTCAGGACCTGGTTGCAGCAGAGGGCCCTGCTGTGGAAACTGGAGATTCTTTAGAAGTAGCCTATACGGGCTGGCTCCTTCAGAA

TCATGTGCTGGGCCAG GTTTTTGATTCTACTGCTAACAAAGATAAGCCGCTTCGCCTAAAATTAGGATCAGGAAAAGTTGTCAAG GGCTTAGAGGACG

GGCTACTGGGCATGAAGAAAGGAGGAAAGCGCTTAATTATCACTCCTTCAGCCTGCGCTGCTGGCTCTGAAGGAGTAATAGGCTGGACTCAGCCAACAGA

CTCCATCCTGGTGTTTGAGGTAGAAGTTAGGCGG GTGAAGTTTGCCAGAGATTCTGGCTCTGATGGCCACAGTGTGAGCTCCCGGGATTCTGCAGCCCC

TTCCCCCATCCCTGCTTCTGACAGCCTCTCTGCTGATCCTGTTGTGACACCCCTGCCATTGCCTCTCAAACCTGG GGAACCGGGTCTTCGTTCCAAATC

TAACTCTCTCAGCGAACAGCTAACTGTAAATTCA AATCCTGATACGGTCAAGGCCAAGCTGATCTCGAGGATGGCTAAAATGGGCCAGCCCATGCTACC

CATCCTTCCGCCACAGCTGGACTCCAATGACTCAGAAACCGAA GATGCAACTGTTCTGCGAGGAGCTGGGCAGTCCCTTGTGACACCATCTATCCAGCC

TTCTCTTCAGCCAGCTCATCCGGTATTACCACAGATGGCCTCACAGG CACCTCAGCCATCTGGTTCTGGGCTCCAGACACCCTCTGCTGCCTTGATGCA

AGCTGTGTCCCTTGATTCTCACTCGGCTGTATCTGGAAATGCACAGAACTTCCAG CCCTATGCAGGTGTGCAAGCCTATGCATATCCCCAGACACCCTC

AGTTACTTCCCAGCTGCAGCCTGTTCGGCCCTTGTACCCAGCACCACTGTCCCAGGCTCCCCACTTTCAAG GATCAGGAGACATGATGTCCTTTCTCAT

GACTGAAGCCCGGCAACACAACACTGAAATTCGAATGGCAGTCAACAAAGTGGCTGATAAAATGGATCACCTCATGACTAAG GTGGAGGAGTTACAGAA

GCATAGCTCTGGCAACTCCATGCTTCTTCCTAGCATGTCGGTCACAATGGAAACAAGCATGATTATGAGCAACATCCAGCGCATCATCCAG GAAAATGA

GAGACTGAAGCAGGAGCTCCTTGAGAAAAGCAGTCGGATAGAAGAGCAGAATGACAAGATTAGTGACCTCATTGAACGCAACCAGAG - UNI4727 - 

ATATGTTGAGCAGAGTAACCTGATGATGGAGAAGAGGAACAACTCGCTTCAAACAGCCACAGAAAACACACAG GCCTACTGGGGTAACCCAAATATACT

CTTTTTCCGCATTGGTACTATTCAGGGATAA
Translation
MFGAGDEDDTDFLSPSGG - UNI28066 - GAKLASLFGLDQATMGHGNEFFQYTAPKQPKKGQGTAAG - UNI1680 - GNQTAPKPAPATTGTS

SVLFATAVHAYRY YINGQYAKQGKFGAAVLGNHTSRE YRILLYISQQQPVTVATIHLNFELM VRPNNYSTFYDDQRQNWSIMFESEKAAVSFNKQ V

CVAKCNSISSLDAVLCQDLVAAEGPAVETGDSLEVAYTGWLLQNHVLGQ VFDSTANKDKPLRLKLGSGKVVK GLEDGLLGMKKGGKRLIITPSACAAG

SEGVIGWTQPTDSILVFEVEVRR VKFARDSGSDGHSVSSRDSAAPSPIPASDSLSADPVVTPLPLPLKPG GEPGLRSKSNSLSEQLTVNS NPDTVKA

KLISRMAKMGQPMLPILPPQLDSNDSETE DATVLRGAGQSLVTPSIQPSLQPAHPVLPQMASQA APQPSGSGLQTPSAALMQAVSLDSHSAVSGNAQN

FQ PYAGVQAYAYPQTPSVTSQLQPVRPLYPAPLSQAPHFQG GSGDMMSFLMTEARQHNTEIRMAVNKVADKMDHLMTK VEELQKHSSGNSMLLPSMS

VTMETSMIMSNIQRIIQ ENERLKQELLEKSSRIEEQNDKISDLIERNQR - UNI4727 - RYVEQSNLMMEKRNNSLQTATENTQ AYWGNPNILFF

RIGTIQG
Transcript ENSMUST00000084528
Sequence
ACTACCCTGAGAGAGTTTGTCCTGCCGGAAAGCAGCTCGCCGCCACGGCGTTTTACGTTACCGGCGGTGACAGGCCCTGGGAACATCCAACTTCCTCCTC

CCTTCAGCTGGGCGAAAGCCGACGTGATGTTCGGTGCCGGAGACGAGGATGACACCGACTTCCTCTCGCCAAGCGGCGG - UNI28066 - AGCTAAG

CTGGCTTCTCTTTTTGGACTGGATCAAGCAACTATGGGCCATGGAAATGAATTCTTCCAGTACACAGCCCCAAAGCAACCTAAGAAAGGCCAGGGAACAG

CAGCAG - UNI1680 - GAAATCAGACAGCACCAAAGCCAGCCCCAGCTACCACAGGCACGTCCTCAGTGCTGTTTGCCACTGCAGTGCATGCATACC

GCTA CATAAATGGTCAATATGCAAAGCAGGGCAAATTTGGAGCGGCTGTCCTGGGGAACCACACAAGCAGAGAG TATAGGATTCTTCTTTACATCAGT

CAGCAGCAGCCAGTGACTGTTGCTACAATTCATCTGAACTTTGAGCTAATG GTTCGGCCCAATAACTACAGCACCTTTTATGATGACCAGAGACAAAAC

TGGTCTATCATGTTTGAGTCAGAGAAGGCCGCTGTGTCATTCAATAAACAG GTGTGTGTGGCCAAGTGCAATAGCATCTCTTCCTTGGATGCAGTGCTG

TGTCAGGACCTGGTTGCAGCAGAGGGCCCTGCTGTGGAAACTGGAGATTCTTTAGAAGTAGCCTATACGGGCTGGCTCCTTCAGAATCATGTGCTGGGCC

AG GTTTTTGATTCTACTGCTAACAAAGATAAGCCGCTTCGCCTAAAATTAGGATCAGGAAAAGTTGTCAAG GGCTTAGAGGACGGGCTACTGGGCATG

AAGAAAGGAGGAAAGCGCTTAATTATCACTCCTTCAGCCTGCGCTGCTGGCTCTGAAGGAGTAATAGGCTGGACTCAGCCAACAGACTCCATCCTGGTGT

TTGAGGTAGAAGTTAGGCGG GTGAAGTTTGCCAGAGATTCTGGCTCTGATGGCCACAGTGTGAGCTCCCGGGATTCTGCAGCCCCTTCCCCCATCCCTG

CTTCTGACAGCCTCTCTGCTGATCCTGTTGTGACACCCCTGCCATTGCCTCTCAAACCTGG GGAACCGGGTCTTCGTTCCAAATCTAACTCTCTCAGCG

AACAGCTAACTGTAAATTCA AATCCTGATACGGTCAAGGCCAAGCTGATCTCGAGGATGGCTAAAATGGGCCAGCCCATGCTACCCATCCTTCCGCCAC

AGCTGGACTCCAATGACTCAGAAACCGAA GATGCAACTGTTCTGCGAGGAGCTGGGCAGTCCCTTGTGACACCATCTATCCAGCCTTCTCTTCAGCCAG

CTCATCCGGTATTACCACAGATGGCCTCACAGG CACCTCAGCCATCTGGTTCTGGGCTCCAGACACCCTCTGCTGCCTTGATGCAAGCTGTGTCCCTTG

ATTCTCACTCGGCTGTATCTGGAAATGCACAGAACTTCCAG CCCTATGCAGGTGTGCAAGCCTATGCATATCCCCAGACACCCTCAGTTACTTCCCAGC

TGCAGCCTGTTCGGCCCTTGTACCCAGCACCACTGTCCCAGGCTCCCCACTTTCAAG GATCAGGAGACATGATGTCCTTTCTCATGACTGAAGCCCGGC

AACACAACACTGAAATTCGAATGGCAGTCAACAAAGTGGCTGATAAAATGGATCACCTCATGACTAAG GTGGAGGAGTTACAGAAGCATAGCTCTGGCA

ACTCCATGCTTCTTCCTAGCATGTCGGTCACAATGGAAACAAGCATGATTATGAGCAACATCCAGCGCATCATCCAG GAAAATGAGAGACTGAAGCAGG

AGCTCCTTGAGAAAAGCAGTCGGATAGAAGAGCAGAATGACAAGATTAGTGACCTCATTGAACGCAACCAGAG - UNI4727 - ATATGTTGAGCAGA

GTAACCTGATGATGGAGAAGAGGAACAACTCGCTTCAAACAGCCACAGAAAACACACAGGCAAGAATATTGCATGCTGAACAAGAGAAG GCCAAGGTAA

CAGAAGAGTTAGCAGCAGCTACTGCACAGGTGTCTCACCTGCAGCTGAAAATGACGGCTCACCAGAAGAAGGAGACAGAATTGCAGTTGCAGCTGACAGA

CAACTTGAAGGAGACAGATCTTCTCAGGGGCCACGTCACCAGGCTCCAGGCTGACCTCTCGG AGCTCCGAGAAGCCTCTGAGCAAACACAGACCAAATT

CAAAAGTGAAAAGCAGAGCCGGCGGCAGCTGGAGCTCAAGGTAACATCCCTGGAGGAAGAGCTGACTGACCTCCGAGCTGAGAAGACCTCCCTTGAAAAG

GTAAATTCCAAAGCCAACTTTCTCTTGGCCCCAAGTGCAGGCGTAGCTGATTAGTAAACCATTTTGTTTTTCTTTTAAAATGGTTATAGTATGAATGTAT

TAGAGAAAAATGTAAACAATACAGAGAAGTATAAAATTAAAAAGTTGTTTTTAATTGCTTCTCTAATTGTATGGGTTATAAATAACAACTATAGACAACA

CATTAGCCCTCAGGGCAGTAGGTTATTGCATATCTCTGTATACAAATGTGCTGATAGCATTTGTAAGCAATACTGAGCTCATATTAAATGCCTTTGAAAG

TGCTGAAGACACTGTACCCATTACTGCTGCTCAGTGGCCTACTGTTAGCCTCCTGTGCAGCTGACCTGGATCAATGGGTGTTTATGTTTCCAGTTTTTCA

TTTCAAACTGCTGAGGACCTCCTTAGGCTGAATAGCTATTTGTTTTGTGTGTGTGTGTGTGTGTTTGGTTCTTTAGACAGGGTCTTTTATGTAGTTCTGG

CTGTCCTGGAGTAATGTAGACCAGGTTATCCTCCAGCTGCTGCCTCTGCCTCCTGAGTGCTGGGATTAAAGTGTGCACCACCATGCCCAGCAACTATGTG

TTTTTATTAGTCATAAAGCTTTCATATATTTCATTCCTATTATTTCTCCAGTGAATTCTGTTTTGGAGTTCTTTATCCTCTTTCCTATAGAACTATTAAG

AGTATTAATCTTTTGTCAGCCATAAACATTGCTAACATTTTTCCATCTTGATATTTTTTTTAAATTTTAATCTTCTCCTTTTTCTTTTTTAAAGATTTAT

TATGCATGATGACGCATGCCTTTAATCCCAGTACTCTGGAGGCAGGTGAACCTCTGTGAGTTTGAGGCCCTTGGTCTTATTTATATAATGAGTCTTAGGC

CAGGCAGGGCTACATCATGAGACCTTGTGTTTAACAGTACATGCATTTAGTCTCAATACTCAGGCAGCAGACCAATGAATCTGTCT
Translation
MFGAGDEDDTDFLSPSGG - UNI28066 - GAKLASLFGLDQATMGHGNEFFQYTAPKQPKKGQGTAAG - UNI1680 - GNQTAPKPAPATTGTS

SVLFATAVHAYRY YINGQYAKQGKFGAAVLGNHTSRE YRILLYISQQQPVTVATIHLNFELM VRPNNYSTFYDDQRQNWSIMFESEKAAVSFNKQ V

CVAKCNSISSLDAVLCQDLVAAEGPAVETGDSLEVAYTGWLLQNHVLGQ VFDSTANKDKPLRLKLGSGKVVK GLEDGLLGMKKGGKRLIITPSACAAG

SEGVIGWTQPTDSILVFEVEVRR VKFARDSGSDGHSVSSRDSAAPSPIPASDSLSADPVVTPLPLPLKPG GEPGLRSKSNSLSEQLTVNS NPDTVKA

KLISRMAKMGQPMLPILPPQLDSNDSETE DATVLRGAGQSLVTPSIQPSLQPAHPVLPQMASQA APQPSGSGLQTPSAALMQAVSLDSHSAVSGNAQN

FQ PYAGVQAYAYPQTPSVTSQLQPVRPLYPAPLSQAPHFQG GSGDMMSFLMTEARQHNTEIRMAVNKVADKMDHLMTK VEELQKHSSGNSMLLPSMS

VTMETSMIMSNIQRIIQ ENERLKQELLEKSSRIEEQNDKISDLIERNQR - UNI4727 - RYVEQSNLMMEKRNNSLQTATENTQARILHAEQEK A

KVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSE ELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKT

SLEKVNSKANFLLAPSAGVAD
Transcript ENSMUST00000084527
Sequence
CCAACTTCCTCCTCCCTTCAGCTGGGCGAAAGCCGACGTGATGTTCGGTGCCGGAGACGAGGATGACACCGACTTCCTCTCGCCAAGCGGCGG - UNI2

8066 - AGCTAAGCTGGCTTCTCTTTTTGGACTGGATCAAGCAACTATGGGCCATGGAAATGAATTCTTCCAGTACACAGCCCCAAAGCAACCTAAGAA

AGGCCAGGGAACAGCAGCAG - UNI1680 - GAAATCAGACAGCACCAAAGCCAGCCCCAGCTACCACAGGCACGTCCTCAGTGCTGTTTGCCACTGC

AGTGCATGCATACCGCTA CATAAATGGTCAATATGCAAAGCAGGGCAAATTTGGAGCGGCTGTCCTGGGGAACCACACAAGCAGAGAG TATAGGATTC

TTCTTTACATCAGTCAGCAGCAGCCAGTGACTGTTGCTACAATTCATCTGAACTTTGAGCTAATG GTTCGGCCCAATAACTACAGCACCTTTTATGATG

ACCAGAGACAAAACTGGTCTATCATGTTTGAGTCAGAGAAGGCCGCTGTGTCATTCAATAAACAG GTGTGTGTGGCCAAGTGCAATAGCATCTCTTCCT

TGGATGCAGTGCTGTGTCAGGACCTGGTTGCAGCAGAGGGCCCTGCTGTGGAAACTGGAGATTCTTTAGAAGTAGCCTATACGGGCTGGCTCCTTCAGAA

TCATGTGCTGGGCCAG GTTTTTGATTCTACTGCTAACAAAGATAAGCCGCTTCGCCTAAAATTAGGATCAGGAAAAGTTGTCAAG GGCTTAGAGGACG

GGCTACTGGGCATGAAGAAAGGAGGAAAGCGCTTAATTATCACTCCTTCAGCCTGCGCTGCTGGCTCTGAAGGAGTAATAGGCTGGACTCAGCCAACAGA

CTCCATCCTGGTGTTTGAGGTAGAAGTTAGGCGG GTGAAGTTTGCCAGAGATTCTGGCTCTGATGGCCACAGTGTGAGCTCCCGGGATTCTGCAGCCCC

TTCCCCCATCCCTGCTTCTGACAGCCTCTCTGCTGATCCTGTTGTGACACCCCTGCCATTGCCTCTCAAACCTGG GGAACCGGGTCTTCGTTCCAAATC

TAACTCTCTCAGCGAACAGCTAACTGTAAATTCA AATCCTGATACGGTCAAGGCCAAGCTGATCTCGAGGATGGCTAAAATGGGCCAGCCCATGCTACC

CATCCTTCCGCCACAGCTGGACTCCAATGACTCAGAAACCGAA GATGCAACTGTTCTGCGAGGAGCTGGGCAGTCCCTTGTGACACCATCTATCCAGCC

TTCTCTTCAGCCAGCTCATCCGGTATTACCACAGATGGCCTCACAGG CACCTCAGCCATCTGGTTCTGGGCTCCAGACACCCTCTGCTGCCTTGATGCA

AGCTGTGTCCCTTGATTCTCACTCGGCTGTATCTGGAAATGCACAGAACTTCCAG CCCTATGCAGGTGTGCAAGCCTATGCATATCCCCAGACACCCTC

AGTTACTTCCCAGCTGCAGCCTGTTCGGCCCTTGTACCCAGCACCACTGTCCCAGGCTCCCCACTTTCAAG GATCAGGAGACATGATGTCCTTTCTCAT

GACTGAAGCCCGGCAACACAACACTGAAATTCGAATGGCAGTCAACAAAGTGGCTGATAAAATGGATCACCTCATGACTAAG GTGGAGGAGTTACAGAA

GCATAGCTCTGGCAACTCCATGCTTCTTCCTAGCATGTCGGTCACAATGGAAACAAGCATGATTATGAGCAACATCCAGCGCATCATCCAG GAAAATGA

GAGACTGAAGCAGGAGCTCCTTGAGAAAAGCAGTCGGATAGAAGAGCAGAATGACAAGATTAGTGACCTCATTGAACGCAACCAGAG - UNI4727 - 

ATATGTTGAGCAGAGTAACCTGATGATGGAGAAGAGGAACAACTCGCTTCAAACAGCCACAGAAAACACACAGGCAAGAATATTGCATGCTGAACAAGAG

AAG GCCAAGGTAACAGAAGAGTTAGCAGCAGCTACTGCACAGGTGTCTCACCTGCAGCTGAAAATGACGGCTCACCAGAAGAAGGAGACAGAATTGCAG

TTGCAGCTGACAGACAACTTGAAGGAGACAGATCTTCTCAGGGGCCACGTCACCAGGCTCCAGGCTGACCTCTCGG AGCTCCGAGAAGCCTCTGAGCAA

ACACAGACCAAATTCAAAAGTGAAAAGCAGAGCCGGCGGCAGCTGGAGCTCAAGGTAACATCCCTGGAGGAAGAGCTGACTGACCTCCGAGCTGAGAAGA

CCTCCCTTGAAAAG - UNI7500 - AACCTCTCAGAGAGGAAAAAGAAGTCAGCTCAGGAGCGCTGCCAGGCGGAGGCAGAGATGGACGAGATTCGCA

AGTCACACCAGGAGGAACTGGACAGACTTCGGCAGCTCTTGAAAAAGGCTCGGGTGTCCACAGACCAAGCAGCTGCAGAGCAG CTGACTCTTGCACAGG

CTGAGCTGCAGAGCCAGTGGGAGGCTAAGTGTGAGCAGCTTTTGGCCTCTGCAAGAGATGAACACCTGCAGCAATACCGAGAAGTGTGCGCGCAGAGGGA

TGCCCATCAACAGAAGCTGGCTCTCCTTCAGGATGAG TGCTTAGCTCTCCAGGCCCAGATCGCAGCCTTCACTGAACAGAAGGAACACATGCAGCGACT

GGAGAAGACTAAGTCCCAGGCACCTGCAGGCAGAGCTGCTGCTGACCCCTCAGAGAAG GTCAAGAAGATCATGAACCAGGTGTTCCAGTCACTGAGGGG

AGAGTTTGAGCTGGAGGAATCTTATGATGGAGGGACCATTCTGAGGACCATCATGCATACAATTAAG ATGGTGACGCTGCAGCTGTTGAACCATCAGGA

GGAAGAGGAGGAAGAGGAAGAGGAGGAGGAAGAGGAGAAGAAGCCCCTGAGACCTTCCCTGGAGCAGCCAGGCCCTGCCACCCCGGGGATGCCTCCAGCA

CCCCCAAGTGGGGAGACGCAGGAGGCTCCCGAGGTGCTGCCAGAACAGGTAGTAGGGGAGACCACCCCACTGCCTCTACAGGCTCTCCCCACGCCAGAGA

ATGGTGCACAGACAAGGAAAGGGGAGCCCGCAGAAGCGGAGGTACCTTCAGAAATCAAAGACAGTTCTCTCCCACCTCAGCCAGCTGGCATCCCAGCTCA

CAGAGTCCTGGGGCCCCCGACTTCAATCCCACCTAAACCTCCAGGACCTGTAACTATGGACTCTGAGTCTGAGGAGATGCTTGCTGCTGACCAGAGAACA

GTGCAGCCCAATGGCTTGTTGGGAGAAGAACATGTCAGGGAAGTAGCCACAGATGGTCTACTGCAAGGCAACTCCAGGAGATTGTCACTGACTCCAGACC

CTGAGAAGGGAGAGCCACCAGCCTTAGACCCTGAAAGCCAAGGAGGAGAAGCTCAGCCTCCTGAGTGCAAACAAGCTGAGGATGTTAGTAGCTCTGGTCC

CCGTGAGACGCTGTTAGACACAGAGCTTGCTTCAGCAGCTGCAGGGACATCCCTCAGGCACAACCAGGACTCCCAGCACTGCAG TCTCTCTGGAGATGA

AGAGGACGAGCTGTTTAAAGGAGCGACTCTGAAAGTTCCGAGGCCCACAGCCCAGCCTGAGGAGGAGGATGAAGATGAGGTG AGCATGAAGGGACGCCC

GCCTCCAACCCCCCTTTTTGGAGACGATGATGATGATGATGACGATGACATTGGCTGGCTGGGGTGAAGACCTAGGAAGCAGGCATGCAGGCTTCCCGCC

CAGCCCTTCCCTAAGCATGGGTTTGCACAGCTGTCTAGGTGAGCCTCAGGGTGCAGTCCTGGTGAACATTCTGAGATAGTGGTTCAGGGCTCTGAGTTAG

CTGCCATCTGAGCCCCCACCTGACCTGCTGAAGAGGATCATGAGGCTGTCTGCAGAACTGCTGTTGTAACAGCCCTCAGTGAGTAACTCTACCATGGAGG

AAGGGCTGGGAGGGTCACCTGCAGCCAGTCACAAGCATCCTGCCATCTCTCCCAAGGTTTTCTTATCATTCATTCTCAAGTTGACCTGGAAGCCCTCCTG

CTCTCCCAGGGCTCATCAGAACTGCTGCGACAGGGTCAGGACCCTTAGGGGAGTCCTCAACAGAGAACTAAGAGACCAATCATGGTGGCCTAGCCTGTGG

TTCTGGGACATGTATCTTCTCTCTCTGCCTTAAATCTTCTAAAAGAGGTCAATGGGTATTTGAAACTAACAAGACTAAAATAATAAAACTTGACTCAGGC

CCTTGAGGGGAAACTGAGTTTGGTTTCCAGG
Translation
MFGAGDEDDTDFLSPSGG - UNI28066 - GAKLASLFGLDQATMGHGNEFFQYTAPKQPKKGQGTAAG - UNI1680 - GNQTAPKPAPATTGTS

SVLFATAVHAYRY YINGQYAKQGKFGAAVLGNHTSRE YRILLYISQQQPVTVATIHLNFELM VRPNNYSTFYDDQRQNWSIMFESEKAAVSFNKQ V

CVAKCNSISSLDAVLCQDLVAAEGPAVETGDSLEVAYTGWLLQNHVLGQ VFDSTANKDKPLRLKLGSGKVVK GLEDGLLGMKKGGKRLIITPSACAAG

SEGVIGWTQPTDSILVFEVEVRR VKFARDSGSDGHSVSSRDSAAPSPIPASDSLSADPVVTPLPLPLKPG GEPGLRSKSNSLSEQLTVNS NPDTVKA

KLISRMAKMGQPMLPILPPQLDSNDSETE DATVLRGAGQSLVTPSIQPSLQPAHPVLPQMASQA APQPSGSGLQTPSAALMQAVSLDSHSAVSGNAQN

FQ PYAGVQAYAYPQTPSVTSQLQPVRPLYPAPLSQAPHFQG GSGDMMSFLMTEARQHNTEIRMAVNKVADKMDHLMTK VEELQKHSSGNSMLLPSMS

VTMETSMIMSNIQRIIQ ENERLKQELLEKSSRIEEQNDKISDLIERNQR - UNI4727 - RYVEQSNLMMEKRNNSLQTATENTQARILHAEQEK A

KVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSE ELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKT

SLEK - UNI7500 - NLSERKKKSAQERCQAEAEMDEIRKSHQEELDRLRQLLKKARVSTDQAAAEQ LTLAQAELQSQWEAKCEQLLASARDEHLQQ

YREVCAQRDAHQQKLALLQDE CLALQAQIAAFTEQKEHMQRLEKTKSQAPAGRAAADPSEK VKKIMNQVFQSLRGEFELEESYDGGTILRTIMHTIK 

MVTLQLLNHQEEEEEEEEEEEEEKKPLRPSLEQPGPATPGMPPAPPSGETQEAPEVLPEQVVGETTPLPLQALPTPENGAQTRKGEPAEAEVPSEIKDSS

LPPQPAGIPAHRVLGPPTSIPPKPPGPVTMDSESEEMLAADQRTVQPNGLLGEEHVREVATDGLLQGNSRRLSLTPDPEKGEPPALDPESQGGEAQPPEC

KQAEDVSSSGPRETLLDTELASAAAGTSLRHNQDSQHCS SLSGDEEDELFKGATLKVPRPTAQPEEEDEDEV SMKGRPPPTPLFGDDDDDDDDDIGWL

G

For any suggestions or comments, please send an email to unitrap@crg.es