Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000066306 (Numa1)
Chromosomal location
Chr 7: 109118357 - 109163472 (+)
Description
nuclear mitotic apparatus protein 1 Gene [Source:MGI Symbol;Acc:MGI:2443665]
RefSeq_dna
NM_133947 
RefSeq_peptide
NP_598708.2 
UniGene
Mm.27259 Mm.473775 
MGI
MGI:2443665 
Uniprot/SPTREMBL
Q3TH77 Q3UNM2 Q80Y35 Q91W16 Q99KG8 
Human Ortholog
ENSG00000137497 (NUMA1)
Omim not available
UniTrap UNI17422
Vector Insertion
Chr 7: 109118484 - 109125893
Public Clones (sanger) E053E12 (ggtc) D136F11 (ggtc) D043D02 (ggtc) P118H10 (ggtc)
Private Clones OST443216 (lexicon) OST429939 (lexicon) OST389490 (lexicon) OST388635 (lexicon)
OST380446 (lexicon) OST379467 (lexicon) OST376612 (lexicon) OST350868 (lexicon)
OST345261 (lexicon) OST340605 (lexicon) OST324585 (lexicon) OST298115 (lexicon)
OST291171 (lexicon) OST274729 (lexicon) OST262887 (lexicon) OST262545 (lexicon)
OST257926 (lexicon) OST252558 (lexicon) OST246789 (lexicon) OST236966 (lexicon)
OST232311 (lexicon) OST224689 (lexicon) OST219018 (lexicon) OST216183 (lexicon)
OST215713 (lexicon) OST202176 (lexicon) OST201272 (lexicon) OST192184 (lexicon)
OST191891 (lexicon) OST184148 (lexicon) OST172244 (lexicon) OST168249 (lexicon)
OST139719 (lexicon) OST136447 (lexicon) OST122468 (lexicon) OST114469 (lexicon)
OST112475 (lexicon) OST106953 (lexicon) OST105450 (lexicon) OST104279 (lexicon)
OST92405 (lexicon) OST91359 (lexicon) OST78330 (lexicon) OST61389 (lexicon)
OST56839 (lexicon) OST56160 (lexicon) OST53751 (lexicon) OST46356 (lexicon)
OST45427 (lexicon) OST44786 (lexicon) OST43055 (lexicon) OST41696 (lexicon)
OST35129 (lexicon) OST33833 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3659
Vector Insertion
Chr 7: 109125965 - 109136239
Public Clones AG0270 (sanger) CD0018 (sanger) RRK162 (baygenomics) RRK410 (baygenomics)
CMHD-GT_411A7-3 (cmhd) PST1077-2 (escells)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24906
Vector Insertion
Chr 7: 109140243 - 109141151
Public Clones not available
Private Clones OST201476 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4697
Vector Insertion
Chr 7: 109144450 - 109144536
Public Clones AC0064 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29064
Vector Insertion
Chr 7: 109150174 - 109155999
Public Clones not available
Private Clones OST9807 (lexicon)
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1449
Vector Insertion
Chr 7: 109162456 - 109162749
Public Clones CF0436 (sanger)
Private Clones OST116175 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000084852
Sequence
CGCAGCTATCGGGACAGAAGAGCGAGGCCTACGCTCCGCGGCTAGAAACTGCCTGGGCCGCTCGTTTGGGTGGAGGAGTGGGAGGAGCAGGCACACAGCA

TGGCATCTTGGCCTTGCTACGCAGAAG - UNI17422 - GTGAGTTGGAGTGAGCTAGAATCAGAAAGATGACACTCCATGCCACCCGGGCAGCTACG

CTCCTTTCTTGG - UNI3659 - GTGAACAGTCTGCATGTTGCTGACCCCGTGGAGACAGTGCTGCAGCTCCAGGACTGCAGCATCTTCATCAAGATT

ATTAACACCAT CCATGACACTAAAGAGGGGCAACAAATCCTACAGCAGCCACTACCGGAAAGACTAGACTTTGTTTGCAGTTTTCTACAGA AAAATCG

GAAACATCCTTCATCTACACAATGCCTGGTATCTGTGCAGAAAGTGATAGAGGGATCCGAGATGGAACTGGCCAAG - UNI24906 - ATGATAATGC

TGTTTTTATATCAGTCCACCATGAGCTCCAGAAACCTCCGGGACTGGGAGCAGTTTGAATATGGGGTTCAG GCTGAGTTAGCGGTCATCCTGAAGTTTA

TGCTGGATCATGAGGAGTCGCTAAACCTTACTGAGGACTTAGAGAGTTTCTTGGAGAAAG TTCCTTACACCCATGCCAGCACCCTCTCAGAAGAGCTTT

CTCCACCCAGCCACCAGACCAAGAGGAAGATTCGCTTCCTAGAAATACAGAGGATTGCTTCATCTTCCAGTGAGAACAA CTTCCTCTCAGGCTCTCCAT

CCTCCCCTATGGGCGACATACTGCAGACCCCACAGTTCCAGATGAGACGACTGAAGAAGCAGCTGGCAGACGAGAGGAGCAACAGAGATGACCTGGAGCT

GGAGCTGTCTGAGAGCCTCAAGCTCCTCACTGAGAAGG ACGCGCAGATCGCCATGATGCAGCAGCGCATTGATCACCTGGCTCTGCTGAATGAGAAGCA

GGCAGCCAGCTCCCAGGAGCCCAGTGAGCTTGAGGAGCTCCGAGGCAAGAATGAAAG - UNI4697 - CCTCACTGTGCGGCTGCATGAGACTTTGAA

GCAGTGTCAGAACCTGAAGACCGAGAAGAGCCAGATGGATCGAAAGATTAGCCAGCTTTCTGAGGAGAATGGGGACCTTTCCTTTAAG GTTCGAGAGTT

TGCAAACCACTTGCAACAACTTCAGGGTGCATTCAACGACCTGATAGAGGAGCACAGCAAGGCTTCTCAGGAGTGGGCAGAGAAGCAGGCTCGTCTGGAA

AATGAGCTCAGCACAGCCCTCCAGGATAAG AAATGTCTTGAAGAGAAGAATGAAATTCTTCAGGGAAAGCTTTCCCAGCTGGAAGATCAAGCAACTCGG

CTGCAGGAGAGCCCAGCCCCGGAGAAGGGTGAGGTGCTAGGAGACGCCTTGCAG CTGGACACTCTAAAGCAAGAGGCAGCCAAACTTGCCACAGACAAC

ACCCAGCTCCAAACCCGCGTAGAGACACTGGAGTGTGAACGTGGCAAGCAGGAAGCCCAGCTGCTTGCTGAACGGAGCCGCTTTGAAGACGAAAAGCAGC

AGCTGGCCAGCTTGATTGCTGACCTTCAGAGCTCCGTCTCTAACCTCAGCCAGGCCAAAGAGGAGTTAGAGCAAGCCTCCCAGGCCCAAGGGGCTCAGCT

CACTGCCCAGTTGACCTCTATGACAGGGCTCAATGCCACCCTGCAGCAGCGAGATCAAGAGCTGGCCAGTCTGAAAGAACAGGCCAAAAAGGAACAGGCT

CAGATGCTACAGACCATGCAAGAGCAAGAACAGGCTGCCCAGGGCCTCCGCCAGCAGGTGGAGCAGCTGAGCAGCAGCCTGAAGCTGAAGGAGCAGCAAT

TAGAAGAGGCAGCCAAGGAGCAGGAGGCAACCAGACAGGATCACGCCCAGCAACTGGCCATCGTTGCTGAGGCTCGAGAGGCCTCTCTAAGGGAACGGGA

TACTGCTCGCCAGCAGCTAGAAACAGTGGAGAAGGAGAAGGATGCCAAGCTAGAGAGTCTGCAGCAGCAACTTCAGGCTGCCAATGATGCTAGGGACAAT

GCGCAGACCTCGGTCACACAGGCTCAGCAGGAAAAGGCAGAGCTGAGCCAAAAGATAGGAGAGCTTCATGCCTGCATTGAAGCTTCCCACCAGGAACAGC

GTCAGGTTCAAGCTCGTGTGACAGAGCTAGAAGCCCAGCTGAAAGCTGAGCAGCAAAAAACAACTGAGCGAGAAAAGGTGGTTCAGGAGAAGGCCCAGCT

CCAGGAGCAGCTCCGGGCCCTTGAGGAGTCTTTGAAGATTACCAAAGGCAGCCTTGAAGAAGAGAAACGCAGGGCTGCAGATGCCCTGAAGGAGCAGCAG

TGCCGTGCCACTGAGATGGAGGCAGAGTCTCGAAGCCTGATGGAGCAGCGGGAGCGGGAACAGAAGGAGTTAGAGCAAGAGAAGGCTGGGCGAAAGGGGC

TGGAGGCCCGGATACAGCAGCTTGAAGAGGCTCATCAGGCTGAGACTGAAGCCTTGCGGCATGAGCTGGCAGAGGCCACAGCTTCCCAGCACAGAGCTGA

GAGTGAGTGTGAGCGGCTCATCAGAGAGGTTGAGAGCCGGCAGAAGCGGTTTGAAGCTAGACAGCAAGAGGAGGCAAGGTACGGTGCCATGTTCCAGGAA

CAGCTGATGGCTTTGAAAGGGGAGAAGACTGGCCAAGAGGTCCAGGAGGAGGCAGTAGAGATCCACAGTGAAGGCCAGCCAGGCCAGCAGCAGAGTCAGC

TAGCCCAGCTTCATGCCAGTCTGGCCAAAGCCATCCAGCAGGTCCAGGAGAAGGAAGTGAGAGCACAGAAGCTGGTAGATGATCTCTCAGCTCTGCAGGA

GAAGATGGCTGCCACTAACAAGGAGGTGGCCTGTCTGAAGACCTTGGTGCTCAAGGCAGGTGAGCAGCAGGAAACAGCCTCACTTGAGCTGCTCAAAGAG

CCCCCGAGAGCTGCAAACAGAGCGTCTGACCAGCTAGGAGAACAGCAGGGACGGCCATTCTCTAGTACACACGCAGCAGTAAAAGCTATGGAGCGTGAAG

CTGAGCAGATGGGCGGTGAACTGGAGAGGCTGCGGGCAGCACTGATCAAGAGCCAGGGCCAGCAGCAAGAGGAGCGTGGGCAACAGGAGAGGGAGGTAGC

ACGGCTGACCCAGGAGCGGGGCCAGGCCCAGGCTGACCTGGCTCAGGAGAAGGCAGCCAAGGCAGAGCTGGAGATGCGACTGCAGAACACCCTCAATGAG

CAGCGTGTGGAGTTTGCTGCCCTACAGGAAGCACTGGCCCATGCCCTGACAGAAAAGGAAGGGACAGACCAAGAGCTTGCCAAACTTCGAGGGCAGGAGG

CAGCTCAAAGAACAGAGCTGAAGGAGCTTCAACAGACTTTGGAACAGCTGAAAATACAGTTAGTGAAGAAAGAAAAAGAGCACCCTGCAGGGGGTGCCAG

TGGAGAAGATGCTTCTGGCCCAGGAACCCAGTCGGAGACAGCTGGAAAGACAGATGCACCAGGCCCTGAGTTGCAGGCACTTCGGGCAGAGATCAGTAAG

CTAGAGCAGCAGTGTCAGCAGCAGCAGCAACAGGTGGAAGGCCTGACACACAGCCTCAAGTCTGAGCGGGCTTGCCGGGCCGAGCAAGACAAAGCCCTGG

AGACACTGCAGGGCCAGTTAGAAGAGAAGGCTCGAGAGCTAGGGCATAATCAGGCTGCCTCAGCTTCAGCTCAGAGAGAGTTGCAAGCCCTCCGTGCTAA

AGCCCAGGACCATAGCAAAGCTGAGGAAGAGTGGAAGGCCCAGGTAGCCCGGGGCCAGCAGGAGGCTGAAAGAAAAAGCAGTCTTATCAGCAGCTTGGAA

GAGGAGGTATCCATCCTGAATCGCCAAGTCCTAGAGAAGGAAGGGGAGAGCAAGGAGTTGAAGCGCCTGGTTGTAGCTGAATCCGAGAAGAGCCAGAAGC

TGGAAGAGAGGCTGCGCCTGCTTCAAGTAGAAACAGCCAGCAATAGTGCCAGGGCAGCAGAACGCAGCTCAGCTCTACGAGAGGAGGTCCAGAGCCTCCG

GGAAGAGGTGGAGAAACAGCGTGTAGTTTCAGAGAACTCGCGGCAGGAGTTGGCCTCACAAGCAGAGCGAGCTGAGGAGTTGGGCCAAGAATTGAAGGCC

TGGCAGGAGAAGTTTTTCCAGAAGGAGCAAGCTCTCTCTGCCCTGCAGCTGGAGCACACCAGCACACAGGCCCTGGTAAGTGAGCTGCTGCCTGCCAAGC

ACCTTTGTCAGCAGCTGCAAGCTGAGCAAGCGGCTGCCGAGAAGCGCTTCCGGGAGGAGCTCGAGCAGAGCAAGCAGGCAGCTGGTGGGCTCCAGGCAGA

GCTGATGCGGGCCCAGCGGGAGCTCGGAGAGCTCGGATCTTTGCGGCAGAAGATAGTTGAGCAGGAGCGAGCAGCCCAGCAGCTGCGGGCAGAGAAGGCC

AGCTATGCAGAGCAGCTGAGCATGCTGAAGAAGGCCCATGGCCTGCTGGCAGAGGAGAACCGGGGGCTGGGAGAGCGGGCCAACCTTGGCCGGCAGTTTC

TGGAAGTAGAACTAGATCAAGCCCGGGAGAAATATGTCCAGGAGTTGGCTGCTGTGCGTACTGATGCTGAGACCCACTTGGCTGAAATGCGACAAGAAGC

ACAGAGTACTAGCCGGGAGCTGGAGGTGATGACTGCCAAGTACGAAGGTGCCAAGGTGAAGGTCCTAGAGGAAAGGCAGAGGTTCCAAGAAGAGAGGCAG

AAACTCACTGCCCAG - UNI29064 - GTGGAAGAACTAAGTAAGAAGCTGACAGAGCATGACCAAGCCAGCAAGGTGCAGCAACAGAAGCTAAAG G

CTTTCCAGGCCCAGAGAGGTGAAAGCCAGCAAGAGGTCCAGCGCCTCCAGACCCAGCTGAACGAGCTGCAGGCCCAGCTGAGCCAGAAGGAGCAGGCAGC

TGAGCATTACAAGCTCCAG ATGGAGAAAGCCAAGACCCATTATGATGCCAAGAAGCAGCAGAACCAAAAGCTGCAGGAACAGCTTCAAGACTTGGAGGA

ACTGCAGAAGGAGAACAAGGAGCTGCGGTCTGAAGCTGAACGTCTGGGCCGTGAGCTGCAGCAGGCAGGGCTGAAGACCAAGGAAGCTGAACAGACCTGC

CGTCACCTTACAGCCCAGGTGCGCAGCCTGGAGGCCCAG GTTGCCCATGCAGACCAGCAGCTTCGTGACTTGGGCAAATTCCAGGTGGCAACTGATGCC

TTAAAGAGCCGTGAGCCTCAAGTGAAACCCCAGCTGGACTTAAGTATTGACAGCCTGGATCTGAGTTTGGAGGAGGGAACCCCATGCAGTGTGGCTAG C

AAGCTGCCTCGTACCCAACCAGATGGTACCAGTGTCCCTGGAGAGCCAGCTTCACCTATCTCCCAGCGCCTGCCCCCCAAAGTGGAATCCCTGGAGAGCC

TCTACTTCACCCCCACTCCTGCTCGGGGTCAGGCCCCCTTGGAGACTAGCCTTGACTCTCTGGGGGATGCCTTCCCTGACTCCGGCCGTAAGACCCGCTC

TGCTCGCCGCCGTACCACACAAATCATCAACATCACTATGACCAAG AAATTAGAATTGGAAGAGCCAGACAGCGCCAACTCATCCTTCTACAGCACGCA

GTCTGCTCCTGCTTCCCAGGCCAACTTGCGAGCCACTTCCTCCACTCAGTCTCTGGCCCGCTTGGGTTCTCCTGATGATGGCAACTCCGCTCTGCTTAGC

CTGCCTGGCTACCGGCCTACCACACGAAGCTCTGCTCGTCGCTCCCAGGCCAGGATGTCCAGTGGGGCCCCCCAAG GGAGGAATAGCTTCTACATGGGC

ACTTGCCAGGATGAGCCCGAGCAGCTGGATGATTGGAACCGCATCGCAGAGTTGCAGCAGCGCAACCGAGTATGCCCCCCGCACCTGAAGACCTGCTACC

CTCTGGAGTCCAGG CCTACCCTGAGCCTGGCCACCATCACTGATGAGGAGATGAAGACTGGAGACCCCAGGGAAACCTTGCGTAGAGCCAGCATGCAGC

CAGCTCAGATTGCTGAGGGTGTTGGCATAACTACCAGGCAGCAGCGCAAACGAGTTTCCTCTGAGACCCACCAGGGCCCTGGCACTCCTGAG TCCAAGA

AAGCTACCAGCTGCTTTCCACGCCCCATGACCCCCAGGGACCGGCATGAAGGACGTAAGCAGAGCAGCACTGCTGACACCCAGAAGAAAGCAGCTCCAGT

TCTCAAACAG GCGGACCGGCGTCAGTCAATGGCTTTCAGCATCCTTAACACACCTAAGAAGCTGGGAAATAGTCTTCTAAGGCGAGGAGCTTCAAAGAA

GACCCCAGCAAAGGTCTCCCCCAATCCTCGCAGTGGAACCCGCCGTTCTCCACGCATTGCCACCACCACAACTGGCACTGCTACTGTTGCCACCACTCCT

CGGGCCAAGGGCAAG - UNI1449 - GTGAAGCATTAAAGAGTCAGCACCAGTGCTTACGTGGCCCCACTGCATTGTCAGCACTGACCTTGCTTGGTC

CTTTCCCTCCTGCTGTCCCTCAGTGCCTTCTCTCAGCTCCCAGGCCAATGGCGGCCAGCCTTCCCCAAGACAATGAGGTTTGCCTGCACCCTGGCCTGCT

ACCTGGACTTTGCCTGGTGCCTTCTAGGCGTCTTTCAGAGATGGCCCAGGAGGCTTGGAGCTTGGACAGTGTGTGGTCTTCTCCCTATCTTGCCTCCTGA

TTTTTTTTTTCTCCCTCCGTTGTTGTTTTGGAAAAAAGTCTACTTTTCCATCTAACTAGATTGAGACTGGATTCTTTAGCCCAGTCTTCCTTAGTCTCTG

GACCTAGAAGGGACCATTGGAGAAGCAGGCTCTGCTTCTCTGTTGTTCCTGGTGGCTGGGCCTTAGCAGGGGTCTTTGCTCTTGAAGCCCAGGATTGGGC

ATGACCTGGTAGGAGCCTCTGTTCTTACCTATTTCCATATACAGCTGCCTGGAGGATGCTTTTTTTCCAGGACAGATAGGTTCTGGATCTCAGGGGTGAG

ATAGGGGGCAGCCTTCAATGGCAGCTCATACTTCACCTTCCCCAGACTTGCACTGGGGTAGGATATGGAACGATGGGGAGGTTTTTAAGGGCCGGGGATG

GATCTTTTCTAAATGTTATTACTTGTAAATAAAGTCTATTTTTCTCCCTTG
Translation
 - UNI17422 - MTLHATRAATLLSW - UNI3659 - VNSLHVADPVETVLQLQDCSIFIKIINTI IHDTKEGQQILQQPLPERLDFVCSFLQK 

KNRKHPSSTQCLVSVQKVIEGSEMELAK - UNI24906 - MIMLFLYQSTMSSRNLRDWEQFEYGVQ AELAVILKFMLDHEESLNLTEDLESFLEKV

 VPYTHASTLSEELSPPSHQTKRKIRFLEIQRIASSSSENN NFLSGSPSSPMGDILQTPQFQMRRLKKQLADERSNRDDLELELSESLKLLTEKD DAQ

IAMMQQRIDHLALLNEKQAASSQEPSELEELRGKNES - UNI4697 - SLTVRLHETLKQCQNLKTEKSQMDRKISQLSEENGDLSFK VREFANHLQ

QLQGAFNDLIEEHSKASQEWAEKQARLENELSTALQDK KCLEEKNEILQGKLSQLEDQATRLQESPAPEKGEVLGDALQ LDTLKQEAAKLATDNTQLQ

TRVETLECERGKQEAQLLAERSRFEDEKQQLASLIADLQSSVSNLSQAKEELEQASQAQGAQLTAQLTSMTGLNATLQQRDQELASLKEQAKKEQAQMLQ

TMQEQEQAAQGLRQQVEQLSSSLKLKEQQLEEAAKEQEATRQDHAQQLAIVAEAREASLRERDTARQQLETVEKEKDAKLESLQQQLQAANDARDNAQTS

VTQAQQEKAELSQKIGELHACIEASHQEQRQVQARVTELEAQLKAEQQKTTEREKVVQEKAQLQEQLRALEESLKITKGSLEEEKRRAADALKEQQCRAT

EMEAESRSLMEQREREQKELEQEKAGRKGLEARIQQLEEAHQAETEALRHELAEATASQHRAESECERLIREVESRQKRFEARQQEEARYGAMFQEQLMA

LKGEKTGQEVQEEAVEIHSEGQPGQQQSQLAQLHASLAKAIQQVQEKEVRAQKLVDDLSALQEKMAATNKEVACLKTLVLKAGEQQETASLELLKEPPRA

ANRASDQLGEQQGRPFSSTHAAVKAMEREAEQMGGELERLRAALIKSQGQQQEERGQQEREVARLTQERGQAQADLAQEKAAKAELEMRLQNTLNEQRVE

FAALQEALAHALTEKEGTDQELAKLRGQEAAQRTELKELQQTLEQLKIQLVKKEKEHPAGGASGEDASGPGTQSETAGKTDAPGPELQALRAEISKLEQQ

CQQQQQQVEGLTHSLKSERACRAEQDKALETLQGQLEEKARELGHNQAASASAQRELQALRAKAQDHSKAEEEWKAQVARGQQEAERKSSLISSLEEEVS

ILNRQVLEKEGESKELKRLVVAESEKSQKLEERLRLLQVETASNSARAAERSSALREEVQSLREEVEKQRVVSENSRQELASQAERAEELGQELKAWQEK

FFQKEQALSALQLEHTSTQALVSELLPAKHLCQQLQAEQAAAEKRFREELEQSKQAAGGLQAELMRAQRELGELGSLRQKIVEQERAAQQLRAEKASYAE

QLSMLKKAHGLLAEENRGLGERANLGRQFLEVELDQAREKYVQELAAVRTDAETHLAEMRQEAQSTSRELEVMTAKYEGAKVKVLEERQRFQEERQKLTA

Q - UNI29064 - VEELSKKLTEHDQASKVQQQKLK AFQAQRGESQQEVQRLQTQLNELQAQLSQKEQAAEHYKLQ MEKAKTHYDAKKQQNQKLQE

QLQDLEELQKENKELRSEAERLGRELQQAGLKTKEAEQTCRHLTAQVRSLEAQ VAHADQQLRDLGKFQVATDALKSREPQVKPQLDLSIDSLDLSLEEG

TPCSVAS SKLPRTQPDGTSVPGEPASPISQRLPPKVESLESLYFTPTPARGQAPLETSLDSLGDAFPDSGRKTRSARRRTTQIINITMTK KLELEEPD

SANSSFYSTQSAPASQANLRATSSTQSLARLGSPDDGNSALLSLPGYRPTTRSSARRSQARMSSGAPQG GRNSFYMGTCQDEPEQLDDWNRIAELQQRN

RVCPPHLKTCYPLESR PTLSLATITDEEMKTGDPRETLRRASMQPAQIAEGVGITTRQQRKRVSSETHQGPGTPE SKKATSCFPRPMTPRDRHEGRKQ

SSTADTQKKAAPVLKQ ADRRQSMAFSILNTPKKLGNSLLRRGASKKTPAKVSPNPRSGTRRSPRIATTTTGTATVATTPRAKGK - UNI1449 - VK

H

For any suggestions or comments, please send an email to unitrap@crg.es