Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000066357 (Wdr6)
Chromosomal location
Chr 9: 108474649 - 108480957 (-)
Description
WD repeat domain 6 Gene [Source:MGI Symbol;Acc:MGI:1930140]
RefSeq_dna
NM_031392 
RefSeq_peptide
NP_113569.1 
UniGene
Mm.335454 
MGI
MGI:1930140 
Uniprot/SPTREMBL
Q3TEZ2 Q3TMH3 Q8CFV1 Q99ME2 
Human Ortholog
ENSG00000178252 (WDR6)
Omim not available
UniTrap UNI9167
Vector Insertion
Chr 9: 108478914 - 108480824
Public Clones RRE091 (baygenomics) IST10544D8 (tigm) IST13682G11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7945
Vector Insertion
Chr 9: 108476332 - 108476431
Public Clones XK593 (baygenomics) RRJ458 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000068700
Sequence
GTCCGTGGCAGCCACAGCAGCTCCAGGAACGTCATGGACGCTTTCGGGGACTATGTCTGGCCGCGGGCGACTTCCGAGCTCATACTCCTCCCGGTTACGG

GTCTGGAGTGTGTTGGGGACAGGCTGCTGGCGG - UNI9167 - GCGAGGGGCCTGATTTACTGGTGTACAACTTGGACCTTGGTGGGCATCTCCGAA

TGGTGAAGAGAGTCCAGAACCTGCTTGGTCACTTTCTCATCCATGGGTTCCGAGTGCGACCAGAGCCTAAAGGAGACCTGGACTCTGAGGCCATGATAGC

TGTGTTTGGGAGCAAGGGCCTCAAAGTTGTGAAAGTCAGCTGGGGTCAAAGCCATCTTCGGGAGCTCTGGCGCTCTGGCCTGTGGAACATGTCCGACTGG

ATCTGGGATGTCCGCTGGATCGAGGGTAACGTAGCCGTGGCCTTGGGCCACAACTCGGTGGTACTGTATGACCCAGTGATAGGGTGCATGCTGCAGGACG

TCCCCTGCACAGACAGGTGTACCCTGTCCTCAGCCTGCCTGGTTGGTGACACCTGGAAGGAACTGACCATCGTGGCTGGCGCGGTTTCCAATGAGCTCCT

GATCTGGTACCCAGCCACTGCTTTAACAGACAACAAACCCGTGGCCCCTGACCGGCGGGTTAGTGGCCATGTGGGTGTCATCTTTAGCATGTCATACCTG

GAAAGCAAGGGCCTGCTGGCAACTGCTTCAGAAGACCGAAGTGTTCGTCTCTGGAAGGTGGGGGACCTCCGGGTGCCTGGGGGTCGGGTTCAGAATATTG

GCCACTGCTTTGGGCACAGTGCCCGAGTGTGGCAGGTGAAGCTCTTAGAGAACTATCTCATCAGTGCAGGAGAAGACTGTGTCTGCTTGGTGTGGAGCCA

CGAAGGCGAGATCCTTCAAGCCTTTCGGGGCCACCGGGGCCGAGGTATCCGGGCCATAGCCACTCACGAGAGGCAGGCCTGGGTGGTCACTGGGGGAGAC

GACTCAGGCATTCGACTCTGGCACCTGGCAGGCCGAGGGTACCCAGGCTTGGGCGTCTCATCCCTGTCCTTCAAATCTCCTAGCCGGCCAGGTGCCCTCA

AGGCTGTGACTCTGGCTGGTTCCTGGCGAGTCCTGGCAGTGACTGATGTGGGGTCCCTGTACCTCTACGACCTTGAGGTCAAGTCCTGGGAGCAGCTGCT

GGAGGACAATCGCTTTCGGTCTTACTGCCTGCTAGAGGCAGCTCCTGGGCCCGAGGGCTTTGGACTCTGTGCCTTGGCCAACGGGGAGGGTCTTGTTAAG

GTGGTTCCCATCAACACCCCCACCGCTGCCGTCGAGCAGAAACTGTTCCAGGGGAAGGTGCACAGCCTGAGCTGGGCCCTTCGTGGTTACGAGGAGCTGC

TTTTGTTAGCATCGGGCCCTGGTGGGGTGATAGCTTGTTTGGAGATCTCAGCTGCACCCACTGGCAAGGCTATCTTTGTCAAGGAACGTTGCCGGTACCT

CCTTCCCCCAAGCAAGCAACGATGGCACACATGTAGTGCTTTCCTGCCCCCGGGTGACTTCCTCGTCTGTGGGGACCGCCGTGGCTCTGTGATGCTATTC

CCTGTCAGACCATGTCTATTCAAAAAGCCTGGGGCCGGAAGCAAGGCTATTACTGCAGCTGAGGCACCTGGAGCTGGTAGTGGGAGCGGTGGGTCTGAGA

GTGTCCCAACAGGAATAGGCCCCGTCTCTACACTCCATTCTCTGCATGGGAAACAGGGTGTGACCTCAGTTACCTGCCATGGTGGCTACCTATACAGCAC

AGGGCGGGATAGCTCCTACTTCCAGCTCTTTGTACATGGCGGCCACCTCCAGCCGGTCCTAAGGCAGAAAGCCTGTCGAGGCATGAACTGGGTAGCTGGG

CTTCGGATGGTGCCTGATGGAAGTATGGTCATCTTGGGTTTCCATGCCAACGAGTTTGTAGTGTGGAGCCCCCGGTCCCATGAGAAGCTGCATATCGTCA

ACTGTGGGGGAGGGCACCGCTCCTGGGCCTTTTCTGATACTGAGGCAGCCATGGCCTTTACCTACCTGAAGGATGGTGAGGTCATGCTCTATCGGGCTCT

AGGTGGCTGCATCCGGCCCAATGTGATTCTCCGGGAGGGTCTGCATGGCCGTGAAATCACATGTGTAAAGCGTGTGGGCACAGTGACCCTGGGCCCTGAA

TTTGAGGTACCCAACTTGGAGCATCCTGACTCCCTGGAGCCTGGCAGTGAGGGGCCTGGTCTGATTGACATAGTGATAACAGGCAGTGAGGACACTACTG

TCTGTGTCCTAGCACTTCCCACCACCACAGGCTCAGCCCACGCCCTCACTTCTGTCTGTAACCATATCTCCTCTGTGCGAGCCCTGGCAGTGTGGGCTGT

TGGCACCCCAGGTGGCCCACAGGATACTCGACCAGGGCTCACTGCTCAGGTAGTGTCTGCAGGGGGCCGAGCGGAGATTCACTGCTTCAGCGTCATGGTC

ACTCCGGACGCTAGCACCCCCAGCCGCCTTGCCTGTCATGTCATGCACCTTTCATCCCACCGGCTGGATGAGTACTGGGACCGGCAGCGGAACAAGCACA

AGATGATCAAGGTGGACCCTGAGACCAG - UNI7945 - GTACATGTCTCTTGCTATTTGTGAGCTTGACAACGATAGGCCTGGCCTCGGCCCTGGCC

CCCTTGTGGCTGCAGCCTGTAGTGATGGAGCAGTGAG GCTCTTTCTCCTGCAGGACTCTGGGCGAATTCTGCATCTCCTAGCTGAGTCTTTCCACCACA

AGCGGTGTGTCCTCAAAGTCCACTCCTTCACACATGAGGCACCTAACCAGCGTCG GAGGCTGATCCTGTGCAGTGCAGCTACAGATGGCAGCCTAGCCT

TCTGGGATCTCACCACGGCAATGGACAAAGGCTCTACTACCCTGGAGCTTCCAGCACACCCTGGGCTTCCCTACC AGATGGGCACCCCCTCCATGACCG

TGCAAGCCCATAGCTGTGGCGTCAATAGCCTGCACACTTTGCCTACACCTGAGGGCCACCACCTTGTGGCCAGTGGCAGTGAGGATGGGTCCCTGCATGT

CTTCACACTTGCTGTGAAGATGCCAGAGCCGGAAGAAGCTGATGGGGAGGCTGAGCTGGTGCCCCAGTTATGTGTCCTAGAGGAATATTCCGTCCCCTGC

GCACATGCTGCCCATGTGACAGGCGTCAAGATCCTAAGTCCCAAGCTCATGGTCTCAGCCTCCATAGACCAGCGGCTGACCTTCTGGCGTCTGGGACAGG

GTGAGCCCACCTTCATGAATAGCACTGTGTACCATGTGCCAGATGTGGCCGACATGGACTGCTGGCCTGTGAGCCCTGAGTTTGGCCACCGCTGTGCTCT

GGCAGGTCAGGGACTTGAGGTTTACAACTGGTATGACTGAGTTATCCCAGTGGGTGGAGAACTGAGCACAGGGCCTGACTGCAGACAGTAGAGCAGGGAT

CAGCTGTCTGTGTCACGCTCAGTGTGCTCTGGGGAGGCGAGGCAGTACCATAGTTCTCGCAAGTATTCCAGTAGGGTGTTGCATAGGAGGACCAAGAACA

CGCCTCACTCTCACAATAGGATGAAACTGTATTTATTCTGACTTTAAGTGCCCAACATCTGTGAGGTCTTGTTTCTTTCCCAGTTGATGCTTTTATAAAC

ATTCCCAGTTATTGGGCCCTTAGATGTGGCTCAGCGGAGGGAGGCCCAGCATAGCCAAGCCTGTGTGGAACACCTCACGCACTGCCCTCAAAAGCTGTAG

GCGAGCAAACATCTGACCAAAGAGGTGTGGCCGAGGTTCCTGAAAGAAAAGCAGCCAGGCGCATCCTCATTTCCCGTGTGCTCAGCCTTGCCCACATTTC

CCGCAGACCCCCCTTGCTGTATGCTCACCCCTAGAATATGTACTCGGTTATAGTAGGAGCTGAAATCCATGCTGAGCTGCACCAGGAACTTGCATACCTA

GAGACAGACGTTGAGTCGTTGAGCTGTTGTCTTTTTTCTTGTGTTACAACCCAGAATAAAGAATAATGTGTG
Translation
MDAFGDYVWPRATSELILLPVTGLECVGDRLLAG - UNI9167 - GEGPDLLVYNLDLGGHLRMVKRVQNLLGHFLIHGFRVRPEPKGDLDSEAMIAV

FGSKGLKVVKVSWGQSHLRELWRSGLWNMSDWIWDVRWIEGNVAVALGHNSVVLYDPVIGCMLQDVPCTDRCTLSSACLVGDTWKELTIVAGAVSNELLI

WYPATALTDNKPVAPDRRVSGHVGVIFSMSYLESKGLLATASEDRSVRLWKVGDLRVPGGRVQNIGHCFGHSARVWQVKLLENYLISAGEDCVCLVWSHE

GEILQAFRGHRGRGIRAIATHERQAWVVTGGDDSGIRLWHLAGRGYPGLGVSSLSFKSPSRPGALKAVTLAGSWRVLAVTDVGSLYLYDLEVKSWEQLLE

DNRFRSYCLLEAAPGPEGFGLCALANGEGLVKVVPINTPTAAVEQKLFQGKVHSLSWALRGYEELLLLASGPGGVIACLEISAAPTGKAIFVKERCRYLL

PPSKQRWHTCSAFLPPGDFLVCGDRRGSVMLFPVRPCLFKKPGAGSKAITAAEAPGAGSGSGGSESVPTGIGPVSTLHSLHGKQGVTSVTCHGGYLYSTG

RDSSYFQLFVHGGHLQPVLRQKACRGMNWVAGLRMVPDGSMVILGFHANEFVVWSPRSHEKLHIVNCGGGHRSWAFSDTEAAMAFTYLKDGEVMLYRALG

GCIRPNVILREGLHGREITCVKRVGTVTLGPEFEVPNLEHPDSLEPGSEGPGLIDIVITGSEDTTVCVLALPTTTGSAHALTSVCNHISSVRALAVWAVG

TPGGPQDTRPGLTAQVVSAGGRAEIHCFSVMVTPDASTPSRLACHVMHLSSHRLDEYWDRQRNKHKMIKVDPETR - UNI7945 - RYMSLAICELDN

DRPGLGPGPLVAAACSDGAVR RLFLLQDSGRILHLLAESFHHKRCVLKVHSFTHEAPNQRR RRLILCSAATDGSLAFWDLTTAMDKGSTTLELPAHPG

LPYQ QMGTPSMTVQAHSCGVNSLHTLPTPEGHHLVASGSEDGSLHVFTLAVKMPEPEEADGEAELVPQLCVLEEYSVPCAHAAHVTGVKILSPKLMVSA

SIDQRLTFWRLGQGEPTFMNSTVYHVPDVADMDCWPVSPEFGHRCALAGQGLEVYNWYD

For any suggestions or comments, please send an email to unitrap@crg.es