Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000066415 (Msl2l1)
Chromosomal location
Chr 9: 100978486 - 101006727 (+)
Description
male-specific lethal 2-like 1 (Drosophila) Gene [Source:MGI Symbol;Acc:MGI:1925103]
UniGene
Mm.388398 Mm.436586 Mm.441346 
MGI
MGI:1925103 
Uniprot/SWISSPROT
Q69ZF8 
Human Ortholog
ENSG00000174579 (MSL2)
Omim not available
UniTrap UNI23934
Vector Insertion
Chr 9: 100979145 - 101002900
Public Clones IST13057A5 (tigm)
Private Clones OST240105 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000085177
Sequence
CGGGAATCCGACGCCTGCGCCGTAGTCCCCACCGTCCCGCTGCCTCCGCGACGTCGCTGCGATGGAGTAAGGGCCCCGCCGTCGGAAGAGAAACGTGTGG

ACCGCTTGGACCCCACCGGGCCCGCTCCCGTGCGCGCCAGCTCCACCCGGAGGTGCCTCCGCGGCCGGACATGCTGCTCGAGCGCAGGCCGCCCGCCGAG

CCGCGGGGCTAGAGCGAACCCGGAGCCCGTCCGGAGCACCCAGCCGCGGCCGTGTCGGACGAACTCGATCGCTGATTTCGCTTGTCTCTCTTTGGTCTGC

AAGTCTCAGGGACAGAGGAGGGGCGCCGAGGCCCCCATGTGTGGGAGGATTGCTTCAGCTTCACAAACTTGCACGGATTTTGGTTGCTGCTTTGGCCAGG

GGTTCTGCTCAGATTTCTTCCGAATTGTTTTAAATTCGCCATTGTTCCCTGGCTGCTTACAAACTTGGATCCGGAATTTCTTTTCAACCGGGAGCCATTG

GTGTCGAAGTGTCTGCAATGAACCCGGTGAATGCTACTGCTCTCTACATTTCCGCGAGCCGCCTAGTGCTCAACTACGACCCCGGAGACCCCAAGGCGTT

TACAGAGATTAACAGGCTCTTGCCTTACTTCCGACAGTCCCTCTCGTGCTGTGTTTGCG - UNI23934 - GACATTTGCTTCAAGATCCTATTGCAC

CCACCAACTCCACCTGCCAACACTATGTCTGCAAAACTTGTAAAGGCAAGAAAATGATGATGAAACCTTCATGTAGCTGGTGCAAAGACTATGAGCAGTT

TGAGGAGAACAAGCAGTTAAGCATCCTAGTGAATTGCTACAAGAAACTGTGTGAATATATAACCCAGACGACACTGGCACGGGATATAATAGAAGCAGTT

GACTGTTCTTCTGATATTTTGGCTTTGCTTAATGACGGATCATTGTTTTGTGAGGAGACCGAGAAACCTTCAGATTCATCCTTCACTCTGTGTTTGACAC

ATTCCCCTTTACCTTCAACTTCAGAACCCACAGCTGATCCTCAAGCTAGCTTATCTCCAATGTCTGAGAGTACCCTCAGCATTGCCATTGGCAGTTCTGT

TATCAATGGTTTGCCTACTTACAATGGGCTTTCAATAGATAGATTTGGTATAAATATCCCTTCACCTGAACATCCAAATACAATTGACGTGTGTAATACT

GTTGATATAAAAACTGAGGATCTGTCTGACAACCTGCCACCTGTCTGTGACACGGTAGCCACTGACTTGTGCTCCACAGGTATTGATATCTGTAGTTTCA

GTGAAGATATAAAACCCGGTGACTCTCTTTTGCTGAGTGTTGAGGAAGTACTCCGCAGCTTAGAAACTGTTTCAAATACAGAAGTTTGCTGTCCTAATTT

GCAGCCAAACTTGGAAGCCACTGTATCCAATGGACCTTTTTTGCAGCTTTCTTCCCAGTCTCTTAGCCATAATGTTTTCATGTCCACCAGCCCTGCACTT

CATGGGTTATCATGTACAGCAGCAACTCCCAAGGTAGCAAAGTTGAATCGAAAACGATCCAGATCTGAAAGTGACAGTGAGAAAGTTCAGCCACTTCCAA

TTTCTACCATTATCCGAGGCCCAACACTGGGGGCATCTGCTCCTGTGACTGTGAAGCGGGAAAGCAAAATCTCTCTTCAACCTATAGCAACTGTTCCCAA

TGGAGGCACGACACCCAAGATCAGCAAGACTGTACTTTTATCTACTAAAAGCATGAAAAAGAGTCATGAACATGGATCCAAGAAATCTCACTCTAAATCC

AAGCCAGGTATTCTTAAAAAAGACAAAGCAGTAAAGGAAAAGATGCCTAGTCATCATTTTATGCCAGGAAGCCCTACCAAGACTGTGTACAAAAAGCCCC

AGGAAAAGAAAGGATGTAAATGTGGGCGTGCTACTCAAAATCCAAGTGTTCTTACATGCCGCGGCCAACGCTGCCCTTGCTACTCTAACCGGAAAGCCTG

CTTAGATTGTATATGTCGTGGCTGCCAAAACTCCTATATGGCCAATGGGGAGAAGAAGCTGGAGGCATTTGCGGTGCCAGAAAAGGCCTTGGAGCAGACC

AGGCTCACTTTGGGCATTAATGTGACTAGCATTGCTGTGCGTAACGCAAGTACCAGCACCAGTGTAATTAATGTCACAGGGTCCCCTGTAACGACATTTT

TGGCTGCCAGTACACATGATGATAAAAGTTTGGATGAAGCTATAGATATGAGATTCGACTGTTAAATCAGTGGGTCTTTAAACCTACCCCTTGGTAGGAA

ATAGCTACAGTTTTACGGCAGCTATGGTTCTGTTGGTTTAACTTGCCGGAGCTCCTGCATATAGATCACTTGTATCAAGTGTTTTCATTGCTAAGTTATA

TGTGTTAGTGTCGGGGAAATAGTTTGCAGATAATGGAGGAGTAACCCTACAACTATATGTTCTTAGTTCTTACAGAACCTCATAGTTTGAGAACAAATGC

TGATGCAACTGATTTATACAAAATGAACTTTGGCAAGGAAATAACAATAACCTCATTGTTTATGGTCATGCTTTGTGCATAATCAAAGTTGATGATTAAA

ATGTAAGGAAGTGGTATCAGTCAGTCCATAAAGATTGCGCTAATTTTTTTGTGAAAAAGTAGCCATTAGTTTATCAGGAGACTTTGTGCTGCCTTCAAAT

GCCGCACTGATATTTCTCCTGTTGAAAAGCTGATGTGTCCAGCTCAACCTTTGTGCTGACATAATACCATTTCTGATCATGAAAATTGGCTACTGGCGTG

TATGTAGCAGTTCTTAAATCAGCAGTATTATGAAAGAAAATTTCCCCCTCATTAGAATGTTTAAGAAATCTGTCTTTTAAAAAAGTGAACAAATAAATTC

CATCAGACCACAAATGTTAAGCTGTTTATGCTTTAAATATTTATGAGTTCAGCCCTCCTTTCTAGTTATCTGATTTACTTCTATGAGAAAATCCTAAGTC

CTTTCACTTTGAGCAATGTTCTATTTGGTAAATAAAGTGAAGAGCTGTTTTATTCTGAATATAACTGAATTTATATAGTTCATGACAGAATTTTTAAAAA

ATATAAAAATAATCTAAAAATTGGGTTTTATTTAAATGAATTCTGGAATAATGCCCCAAATGTGCCCAGACTTATGCATTATACTTATTGCCATTGACAA

CTTCTTTTTTATTTATTTCCTATTTGCCACGGGCTTTACCTTGAATATGCTCCTTTTTTTCCTTTTCTTTCTTTTCTTTTTTCTTTTTTAGGGTGCTGTT

CAAAATGAAGGCTTCTTCATCAAGGCCTTTAGTGAAGCCTGGGCATTTAGGTCTAAAGCTCGGAGGATCTTCTTTAGATGCTCTTGCATGTAAAGCACAA

ACTGTTTCAGTTTAATGTACTTCCTCCTACTAACTTTATGGGGAAGATAAACATTCTGTTGATGGGAGGTCCTAGTCAGTTGCTTGAGAGAGCACAGCCC

AGGTTAAACAAGGACTGACTAGGTGTAGAGAGAACCTTGTGATTTCAAAGAGTTGCTGCTTTGGCAGTGCTTGTTCTAAGAAAAATACTGCTAGGGAAGT

TCCAACTTCTACTGCACTCAACATCTAGTGAGATCTGATGTGTTGAAGTTGTTTTGGTTTGGCACACAGCATGTTCAATGATGGTTACTCGCCTCACAAA

GACATGGAGAAGAATCCTTTGGACACAGCAGATGACACCTCCTGTTTTGTAGTGTATCCTGGTGTCATTTTCTGGGGATGTGGTCAGGTAGTTGTTTTGT

TGTTGTCATTGGGCTTTTTAAAAAAACAAAAAAATACCAAAAAAATTTTTTGGTCTCTTTGGGTGGGGCGGGGGTGGGCTAAAGCCATAGGAAGGAAATG

TGATGTATGTGTCCAGTATGTACGATTTTGTTTTTGTTTTGCAAGAAGAGTTGAACTATTTTTGATAACAAGAGTAAATGGTGGAAAATGCTTCTTAGTT

GTCTTGTCTTTATTTGCTTACCAAGTTTTGGAATTTTATTTAAATCTTTAAATGATAGCAGTGTCTTATGAAACATGTATTTACCTGAACTTTGTAACAG

TTTTTGTGTTGAACCATATTCCCTGCTATATAATCGTGTAAATCTGTTTTTTATTCACTAATGATCACTGCAGAAATGACTAGAAATGAGATTGTACACA

TGGATAATTAGGCTATATTTTGCAAATCTCCCAAACTTTCCTAGTATCTTAAAATTCATGGAGTACCTAATTGCTTCCCAAATTTGATCACTTTGTTTCT

TGATGCATGGGAGGTCGGCAATATAGACAAAGTGGACATTAGTATGTGAGGGCCTTGATTGATCTGTAATATTGCCAATGATGAATTCAGGTTGTTTTTA

GCACAAGTTTCTCTTTTTTATGCTGGTATTCTCACTGCCACATTTTTGGAAACCTGTATTACACCTTAAATCTATCAATAAATGATAGTTTTCTAATTCT

Translation
IRHCSLAAYKLGSGISFQPGAIGVEVSAMNPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCG - UNI23934 - GHLLQDPIAP

TNSTCQHYVCKTCKGKKMMMKPSCSWCKDYEQFEENKQLSILVNCYKKLCEYITQTTLARDIIEAVDCSSDILALLNDGSLFCEETEKPSDSSFTLCLTH

SPLPSTSEPTADPQASLSPMSESTLSIAIGSSVINGLPTYNGLSIDRFGINIPSPEHPNTIDVCNTVDIKTEDLSDNLPPVCDTVATDLCSTGIDICSFS

EDIKPGDSLLLSVEEVLRSLETVSNTEVCCPNLQPNLEATVSNGPFLQLSSQSLSHNVFMSTSPALHGLSCTAATPKVAKLNRKRSRSESDSEKVQPLPI

STIIRGPTLGASAPVTVKRESKISLQPIATVPNGGTTPKISKTVLLSTKSMKKSHEHGSKKSHSKSKPGILKKDKAVKEKMPSHHFMPGSPTKTVYKKPQ

EKKGCKCGRATQNPSVLTCRGQRCPCYSNRKACLDCICRGCQNSYMANGEKKLEAFAVPEKALEQTRLTLGINVTSIAVRNASTSTSVINVTGSPVTTFL

AASTHDDKSLDEAIDMRFDC

For any suggestions or comments, please send an email to unitrap@crg.es