Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000066442 (Mthfs)
Chromosomal location
Chr 9: 89105995 - 89135059 (+)
Description
5, 10-methenyltetrahydrofolate synthetase Gene [Source:MGI (curated);Acc:Mthfs-001]
RefSeq_dna
NM_026829 
RefSeq_peptide
NP_081105.1 
UniGene
Mm.461300 Mm.196770 
MGI
MGI:1340032 
Uniprot/SWISSPROT
Q9D110 
Uniprot/SPTREMBL
B2KF83 B2KF82 
Human Ortholog
ENSG00000136371 (MTHFS)
Omim not available
UniTrap UNI18185
Vector Insertion
Chr 9: 89109320 - 89110046
Public Clones not available
Private Clones OST428142 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000118887
Sequence
GGGGCGCGTGCGCGTCGTCCGGGGAGCGCGCTCCGCAGGCAAGGGCGGCTCTCGCTGGTCCTGGAGCTTGTGAGGGAGCGAGCTGAGCTTCCGGGCAG -

 UNI18185 - GTGATTGCCCACAATCAGTATCAGAATTCCAAAAGAATTTCCATCTTTCTAAGCATGCAAGATGAAGTTGAGACGGAAGTAATCATCA

AGGACATTTTCAAACAAGGCAAAATCTGCTTCATCCCTCGGTACCAATTCCAGAGCAATCACATGGACATGGTGAGGTTAACGTCATCTGAAGAAATTGC

TTTACTTCCCAAGACATCTTGGAATATTCATCAGCCTGGTGAGGGAGATGTTCGGGAGGAGGCCTTATCCACTG TTTTCTAAAGGAGGTGTGTAAACTG

GATTTCTCGAGGCTGTGTTGGATGAATTGCATACCTTTCTCCAAGCCCAGCAGATGTCAGTGTTTCACAGATGTACAGACTAAAGCAGTGCCTTCGTCCA

CAATCTCCACATGTGTGTGTCCCTTAGTCATTTACATTAGTCACTGAAGTGGGGTCAACTGGAGACAACCCAAGTCAGGTTTTTACCTGGAGGTAAGGGA

ATGGGCCTCTGTGGGAAACGATTCATCAATGTCACACAGTGAACCATGAAGCTAAGCCAAGTGTTTTTGTTTCTAAGACTCTCCATTTTCAGAACTGATT

AAAAATAGGTACCCAAATCATGGAGATCAAAAAAGGATAATCCAGAGTAGATGCCCCACTTATGGAGGAAAAAGAGGCAAATGCTGTTCCATTTGTTTGG

GTGTGCAGACAGCAGTTCAGTCATGATGAATAAGATGCTGGCAGTATCTGAAAGCAGCTAGCTGGAGAAGGAGTTGCTACATGGGAAAGTGACCTTTGAA

AACCATTCTGTGCTTGCTTTGACCATAGAGCTCATGTGACACCAGTGCCAGTACTTGTGTGACACCTGAATGATTCCCACATTCTGTCCACTCATAGCCT

TATCCAGTGCATTGGAGCAAAATCATACAAACCATTTAGTTCTTTCTTCTTTTTGAGAGGCACTTATCACTGTCCCCAAACATATGGCAATCTCCCCAAA

TCTGTGAGTTTGTTTATTTTATTTTGATGCACAGGCCATTGCAGCCCCTCTTCCAGACCCCTGTAAGTTCTGTTATTCCAGCACCCACTTCCTTAATGTC

ATTTTCCTGGACTTAAGCACTTGCCAGTGGGGTACCATGATCTCCTTTCTGTTTTTTGCCTTGGCACATGTACTACTCCATCTATTACGGTTTAGGTGTT

CCTTACACTCAACTTCTTGGGTGTGGTTTTAGCTAAGCAAGTTGTTAGTACTTTGTTGGCAAATACCTGTCCCATGTTCTTATAGTTCCTTGGATGAGGC

TAGCATATTTATAGAATTATTAATAATGACTAGTTATTGACTTGATTGTATTGAATTTCTGATAAATAAAAAAGCTTTGT
Translation
 - UNI18185 - MQDEVETEVIIKDIFKQGKICFIPRYQFQSNHMDMVRLTSSEEIALLPKTSWNIHQPGEGDVREEALSTV VF
Transcript ENSMUST00000118870
Sequence
GAGGGTGATGGGCGTGGCCGGGGCGGTGCTTGCCAGGAATGGCGGCGGTCACGGTAAACAGTGCCAAGCGGGGCCTGCGGGCCGAGCTGAAGCAGCGCTT

GAGGGCCTTGAGCGCGGAGGAACGGCTGCGCCAGTCTCTCCTCCTCACGCAGAAG - UNI18185 - GTGATTGCCCACAATCAGTATCAGAATTCCA

AAAGAATTTCCATCTTTCTAAGCATGCAAGATGAAGTTGAGACGGAAGTAATCATCAAGGACATTTTCAAACAAGGCAAAATCTGCTTCATCCCTCGGTA

CCAATTCCAGAGCAATCACATGGACATGGTGAGGTTAACGTCATCTGAAGAAATTGCTTTACTTCCCAAGACATCTTGGAATATTCATCAGCCTGGTGAG

GGAGATGTTCGGGAGGAGGCCTTATCCACTG TTTTCTAAAGGAGGTGTGTAAACTGGATTTCTCGAGGCTGTGTTGGATGAATTGCATACCTTTCTCCA

AGCCCAGCAGATGTCAGTGTTTCACAGATGTACAGACTAAAGCAGTGCCTTCGTCCACAATCTCCACATGTGTGTGTCCCTTAGTCATTTACATTAGTCA

CTGAAGTGGGGTCAACTGGAGACAACCCAAGTCAGGTTTTTACCTGGAGGTAAGGGAATGGGCCTCTGTGGGAAACGATTCATCAATGTCACACAGTGAA

CCATGAAGCTAAGCCAAGTG
Translation
MAAVTVNSAKRGLRAELKQRLRALSAEERLRQSLLLTQK - UNI18185 - VIAHNQYQNSKRISIFLSMQDEVETEVIIKDIFKQGKICFIPRYQFQ

SNHMDMVRLTSSEEIALLPKTSWNIHQPGEGDVREEALSTV VF
Transcript ENSMUST00000117314
Sequence
GGGGGCGCGTGCGCGTCGTCCGGGGAGCGCGCTCCGCAGGCAAGGGCGGCTCTCGCTGGTCCTGGAGCTTGTGAGGGAGCGAGCTGAGCTTCCGGGCAG 

CTTGAAGGACAGGGGGGACAGAAAAGCAGTGGACACAGAAAGGGAGTAAGGGGCCGGCTTCTGAGTCTGG - UNI18185 - GTGATTGCCCACAATC

AGTATCAGAATTCCAAAAGAATTTCCATCTTTCTAAGCATGCAAGATGAAGTTGAGACGGAAGTAATCATCAAGGACATTTTCAAACAAGGCAAAATCTG

CTTCATCCCTCGGTACCAATTCCAGAGCAATCACATGGACATGGTGAGGTTAACGTCATCTGAAGAAATTGCTTTACTTCCCAAGACATCTTGGAATATT

CATCAGCCTGGTGAGGGAGATGTTCGGGAGGAGGCCTTATCCACTG GTGGACTTGACCTCATCTTCCTTCCTGGCCTCGGGTTTGACAAAGATGGCAAC

CGGCTGGGGCGGGGTAAGGGGTACTATGACACCTACCTGAAGCGCTGTGTACAGCATCAGGAAGTGAAGCCCTACACCATGGCTTTGGCTTTTAAAGAGC

AGATCTGTCCCCAGATCCCAGTGGATGAGCATGACATGAAGGTAGATGAAGTCCTTTATGAAGATTCCCCAGCATCCTAAGTTACACCACGACGGCTACA

CTTACTGCTCTGTCCCGGTGT
Translation
  - UNI18185 - MQDEVETEVIIKDIFKQGKICFIPRYQFQSNHMDMVRLTSSEEIALLPKTSWNIHQPGEGDVREEALSTG GGLDLIFLPGLGFD

KDGNRLGRGKGYYDTYLKRCVQHQEVKPYTMALAFKEQICPQIPVDEHDMKVDEVLYEDSPAS
Transcript ENSMUST00000085256
Sequence
ATGGCGGCGGTCACGGTAAACAGTGCCAAGCGGGGCCTGCGGGCCGAGCTGAAGCAGCGCTTGAGGGCCTTGAGCGCGGAGGAACGGCTGCGCCAGTCTC

TCCTCCTCACGCAGAAG - UNI18185 - GTGATTGCCCACAATCAGTATCAGAATTCCAAAAGAATTTCCATCTTTCTAAGCATGCAAGATGAAGTT

GAGACGGAAGTAATCATCAAGGACATTTTCAAACAAGGCAAAATCTGCTTCATCCCTCGGTACCAATTCCAGAGCAATCACATGGACATGGTGAGGTTAA

CGTCATCTGAAGAAATTGCTTTACTTCCCAAGACATCTTGGAATATTCATCAGCCTGGTGAGGGAGATGTTCGGGAGGAGGCCTTATCCACTG GTGGAC

TTGACCTCATCTTCCTTCCTGGCCTCGGGTTTGACAAAGATGGCAACCGGCTGGGGCGGGGTAAGGGGTACTATGACACCTACCTGAAGCGCTGTGTACA

GCATCAGGAAGTGAAGCCCTACACCATGGCTTTGGCTTTTAAAGAGCAGATCTGTCCCCAGATCCCAGTGGATGAGCATGACATGAAGGTAGATGAAGTC

CTTTATGAAGATTCCCCAGCATCCTAAGTTACACCACGACGGCTACACTTACTGCTCTGTCCCGGTGTAAAGAACATATGTATATTTTTCTCTTGTCAAA

ATGAATCAAAATGGCACATTAAAGTGAATATGGGTTGTGATTTTAAGTATAAAAATAAAATAATATAAAATCCT
Translation
MAAVTVNSAKRGLRAELKQRLRALSAEERLRQSLLLTQK - UNI18185 - VIAHNQYQNSKRISIFLSMQDEVETEVIIKDIFKQGKICFIPRYQFQ

SNHMDMVRLTSSEEIALLPKTSWNIHQPGEGDVREEALSTG GGLDLIFLPGLGFDKDGNRLGRGKGYYDTYLKRCVQHQEVKPYTMALAFKEQICPQIP

VDEHDMKVDEVLYEDSPAS

For any suggestions or comments, please send an email to unitrap@crg.es