Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000066568 (Lsm14a)
Chromosomal location
Chr 7: 35129738 - 35174559 (-)
Description
LSM14 homolog A (SCD6, S. cerevisiae) Gene [Source:MGI (curated);Acc:Lsm14a-001]
RefSeq_dna
NM_025948 
RefSeq_peptide
NP_080224.1 
UniGene
Mm.469602 Mm.276503 
MGI
MGI:1914320 
Uniprot/SWISSPROT
Q8K2F8 
Uniprot/SPTREMBL
A2BH68 A2BH69 A2BH30 
Human Ortholog
ENSG00000105216 (LSM14A)
Omim not available
UniTrap UNI29452
Vector Insertion
Chr 7: 35160630 - 35174376
Public Clones YTC822 (baygenomics) IST14650B9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21765
Vector Insertion
Chr 7: 35160412 - 35160616
Public Clones not available
Private Clones OST318554 (lexicon) OST268078 (lexicon) OST127883 (lexicon) OST115969 (lexicon)
OST99063 (lexicon) OST84045 (lexicon) OST67133 (lexicon) OST32145 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38207
Vector Insertion
Chr 7: 35156073 - 35160412
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6941
Vector Insertion
Chr 7: 35150757 - 35156073
Public Clones RRX358 (baygenomics) XC333 (baygenomics) XC807 (baygenomics) CMHD-GT_411E8-3 (cmhd)
IST14421H8 (tigm)
Private Clones OST442808 (lexicon) OST426018 (lexicon) OST375154 (lexicon)
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12219
Vector Insertion
Chr 7: 35142962 - 35150633
Public Clones A049D08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17033
Vector Insertion
Chr 7: 35138683 - 35138867
Public Clones not available
Private Clones OST450588 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29680
Vector Insertion
Chr 7: 35138683 - 35142516
Public Clones E119F04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108071
Sequence
ATAGAAGTAAAAT - UNI21765 - TTCGATCCTTCGGTACAGAAGACAGACCAACAGATCGTCCAATACCGCCTCGAGATGAAGTCTTTGAATATAT

TATATTCCGCGGGAGTGATATTAAAGACCTCACTGTTTGTGAGCCACCCAAACCACAATGTTCTTTGCCTCAGGACCCGGCTATTGTTCAG TCTTCACT

AGGTTCGTCGTCATCTTCATTCCAGTCGGTGGGTTCCTATGGACCTTTTGGCAGGATGCCAGCATACAGTCAGTTCAGTCCAAGTACATTAGTTGGGCAG

CAGTTTGGTGCTGTTGGTGTTG - UNI6941 - CTGGAAACTCTTTGACATCCTTTGGAACAGAAGCATCAAATAGTGGTACCTTATCCCAGAGCAAT

GCAGTTGGTTCGGCCTTCACACAAGACACAAGATCTGTAAAACCACAGCTAGCCCAAG - UNI12219 - - UNI29680 - CTGAAGTACACAAAG

TCCCAAGGCCAGAAAATGAGCAACTCAGAAATGACAAGAGGCAAGTAG - UNI17033 - - UNI29680 - TTCCTGGAGTTCCTTCTGCTCCAAG

AAGAGGACGTGGGGGTCATCGAGGTGGCAGGGGAAGATTTGGTATCCGTCGAGATGGTCCAATGAAATTTGAGAAAGACTTTGACTTTGAAAGTGCAAAT

GCACAATTTAACAAGGAGGAAATTGACAGAGAGTTTCATAATAAACTTAAACTGAAAG - UNI17033 - - UNI29680 - AAGATAAACTTGAGA

AACAAGAGAAACCTGTAAACGGTGAAGACAAAGGAGACTCAGGAGTCGACACTCAGAACAGTGAAGGGAATGCTGATGAGGAAGATCCCCTTGGGCCCAA

CTGCTACTATGACAAGACCAAGTCCTTCTTTGACAACATCTCTTGTGATGATAATAG AGAAAGGAGACCAACTTGGGCTGAAGAAAGAAGGTTAAATGC

TGAAACTTTTGGCATCCCGCTTCGTCCAAACCGTGGCCGTGGAGGCTACCGAGGCAGAGGAGGCCTTGGCTTCCGTGGTGGCAGAGGGCGTGGTAGTGGC

CGAGGAGGAACCTTCACTGCCCCTCGAGGGTTTCGTGCTGGATTCAGAGGCGCTCGTGGTGGTAGGGAGTTTGCAGACTTTGAATATAGG AAAACCACG

GCTTTTGGACCCTAAAAGGTCTGGATTGGTCATACTGCTTTCTGAAAG AAAGACAACAAAGTTGCTGCATAGTCTACAAACAAGTCTTTGAAAATAGGT

GACTCCTAGCTCTTCATGGTCCTGGAAAGTGCTTTCAGTCTTTGTGAAGAATGAAGAAGTGAAGTTGCTGTCTTGCCTGTCACCAGCACTGGGTTTTGTC

TGTTTTCTGCTTCATTTCAAAGCTACACTGCAGTTGCTTTGGGGCAGGAAGGCTCGTCTTAAAACACAAGTATAAGTGTATGTGGAGTAGCAGATGGTTG

TGATTCCTTGTTTAGAGTTGAACTAAAGCCAGCTAAATGGAACTGCTAAGTATTTTTTCATCACTGAAAGGATTTTCTTATCACTAATTAATTGTATTCG

GCAATTACTTCCAATTGCCTGCAGATAGGCCGTGATACTGTGTTTTGAGCCACAGAAGGTTTTGTGCGTGTGTGTGTGTATGTATGTGTGTGTGCGCGCG

CGCGTGTATGTGCGTGTCTTTTTCTTTTTGGAGATCCTATAATATGAGGTAGCTTATTTCGACACTTAATTAGGGTGCTGGATGGTAGAGAATTTTGTCA

GTCAACTATGTACACACAGGTAAATACTGTTTCTTAGGCAAAGGTAACTTTTTTATATAGTTGTAAAATTCCATTATATTCCATTGCCAAAGAAACATTA

AGAACTTTGTATAGCTGTATAAAAAGCAACTAATTTTTTAAAGAATAAACGTTTTAAAGTCAGCAAACATACGTGTCCTTGCAGAAGTCAGTGTGCTGAG

GAGCAGGGATATGGGTGGGTCTTTCCCCTTGCTTTCCAGGCTTAAGGTTTTTGATTTCCTTTGTACTGTTTGGACTAAAGTGAAGATTTGATAACTTTAT

TCCATTATCTAAAAAGCATAAATTATTCATGCATAGTGTATGGACTTCGTTTTGTAGCAAATCACAGGATTTGTTCAAATAACAGATCTTTTAAGTGTAT

GAATGTAAATAATCATAGATGAGAGTGTACCTCGCTGTATTTTCAAATAAGTAACCTTTTTAAGACATTAAAACTCAATATATCAGTTGACCCATTCCTC

CTGCTATGCCTGGAATTCTGTTGTGGTAACCGCTGACTCCTGTTTTATGTCAAAAAGATGGAGTTTTCAGAATCCTCTGGCACCTGTAAAACATCACTAA

CATAGTATGCGGGCCTGTGGCCTTCTAATGACTCTGTACACGGTTGTTGCTAACTGTAAATTACTAATAAATCTTTTTTGATATTTAAA
Translation
IEVKF - UNI21765 - FRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQ SSLGSSSSSFQSVGSYGPFGRMPAY

SQFSPSTLVGQQFGAVGVA - UNI6941 - AGNSLTSFGTEASNSGTLSQSNAVGSAFTQDTRSVKPQLAQA - UNI12219 - - UNI29680 -

 AEVHKVPRPENEQLR - UNI17033 - - UNI29680 -  - UNI17033 - - UNI29680 -    
Transcript ENSMUST00000108072
Sequence
GGAGCGGCGGGCGCAGCGCGGGATCTGACTGAGTGCGAGCGGCGGGCGACGGCGGCGGCGCCATGAGCGGGGGCACCCCTTACATCGGCAGCAAGATCAG

CCTCATCTCCAAGGCGGAGATCCGCTACGAGGGCATCCTCTACACCATCGACACCGAGAACTCCACGGTAGCCCTCGCCAAAG - UNI21765 - - U

NI29452 - TTCGATCCTTCGGTACAGAAGACAGACCAACAGATCGTCCAATACCGCCTCGAGATGAAGTCTTTGAATATATTATATTCCGCGGGAGTG

ATATTAAAGACCTCACTGTTTGTGAGCCACCCAAACCACAATGTTCTTTGCCTCAGGACCCGGCTATTGTTCAG TCTTCACTAGGTTCGTCGTCATCTT

CATTCCAGTCGGTGGGTTCCTATGGACCTTTTGGCAGGATGCCAGCATACAGTCAGTTCAGTCCAAGTACATTAGTTGGGCAGCAGTTTGGTGCTGTTGG

TGTTG - UNI6941 - CTGGAAACTCTTTGACATCCTTTGGAACAGAAGCATCAAATAGTGGTACCTTATCCCAGAGCAATGCAGTTGGTTCGGCCTT

CACACAAGACACAAGATCTGTAAAACCACAGCTAGCCCAAG - UNI12219 - - UNI29680 - CTGAAGTACACAAAGTCCCAAGGCCAGAAAAT

GAGCAACTCAGAAATGACAAGAGGCAAGTAG - UNI17033 - - UNI29680 - TTCCTGGAGTTCCTTCTGCTCCAAGAAGAGGACGTGGGGGTC

ATCGAGGTGGCAGGGGAAGATTTGGTATCCGTCGAGATGGTCCAATGAAATTTGAGAAAGACTTTGACTTTGAAAGTGCAAATGCACAATTTAACAAGGA

GGAAATTGACAGAGAGTTTCATAATAAACTTAAACTGAAAG - UNI17033 - - UNI29680 - AAGATAAACTTGAGAAACAAGAGAAACCTGTA

AACGGTGAAGACAAAGGAGACTCAGGAGTCGACACTCAGAACAGTGAAGGGAATGCTGATGAGGAAGATCCCCTTGGGCCCAACTGCTACTATGACAAGA

CCAAGTCCTTCTTTGACAACATCTCTTGTGATGATAATAG AGAAAGGAGACCAACTTGGGCTGAAGAAAGAAGGTTAAATGCTGAAACTTTTGGCATCC

CGCTTCGTCCAAACCGTGGCCGTGGAGGCTACCGAGGCAGAGGAGGCCTTGGCTTCCGTGGTGGCAGAGGGCGTGGTAGTGGCCGAGGAGGAACCTTCAC

TGCCCCTCGAGGGTTTCGTGCTGGATTCAGAGGCGCTCGTGGTGGTAGGGAGTTTGCAGACTTTGAATATAGG AAAACCACGGCTTTTGGACCCTAAAA

GGTCTGGATTGGTCATACTGCTTTCTGAAAG AAAGACAACAAAGTTGCTGCATAGTCTACAAACAAGTCTTTGAAAATAGGTGACTCCTAGCTCTTCAT

GGTCCTGGAAAGTGCTTTCAGTCTTTGTGAAGAATGAAGAAGTGAAGTTGCTGTCTTGCCTGTCACCAGCACTGGGTTTTGTCTGTTTTCTGCTTCATTT

CAAAGCTACACTGCAGTTGCTTTGGGGCAGGAAGGCTCGTCTTAAAACACAAGTATAAGTGTATGTGGAGTAGCAGATGGTTGTGATTCCTTGTTTAGAG

TTGAACTAAAGCCAGCTAAATGGAACTGCTAAGTATTTTTTCATCACTGAAAGGATTTTCTTATCACTAATTAATTGTATTCGGCAATTACTTCCAATTG

CCTGCAGATAGGCCGTGATACTGTGTTTTGAGCCACAGAAGGTTTTGTGCGTGTGTGTGTGTATGTATGTGTGTGTGCGCGCGCGCGTGTATGTGCGTGT

CTTTTTCTTTTTGGAGATCCTATAATATGAGGTAGCTTATTTCGACACTTAATTAGGGTGCTGGATGGTAGAGAATTTTGTCAGTCAACTATGTACACAC

AGGTAAATACTGTTTCTTAGGCAAAGGTAACTTTTTTATATAGTTGTAAAATTCCATTATATTCCATTGCCAAAGAAACATTAAGAACTTTGTATAGCTG

TATAAAAAGCAACTAATTTTTTAAAGAATAAACGTTTTAAAGTCAGCAAACATACGTGTCCTTGCAGAAGTCAGTGTGCTGAGGAGCAGGGATATGGGTG

GGTCTTTCCCCTTGCTTTCCAGGCTTAAGGTTTTTGATTTCCTTTGTACTGTTTGGACTAAAGTGAAGATTTGATAACTTTATTCCATTATCTAAAAAGC

ATAAATTATTCATGCATAGTGTATGGACTTCGTTTTGTAGCAAATCACAGGATTTGTTCAAATAACAGATCTTTTAAGTGTATGAATGTAAATAATCATA

GATGAGAGTGTACCTCGCTGTATTTTCAAATAAGTAACCTTTTTAAGACATTAAAACTCAATATATCAGTTGACCCATTCCTCCTGCTATGCCTGGAATT

CTGTTGTGGTAACCGCTGACTCCTGTTTTATGTCAAAAAGATGGAGTTTTCAGAATCCTCTGGCACCTGTAAAACATCACTAACATAGTATGCGGGCCTG

TGGCCTTCTAATGACTCTGTACACGGTTGTTGCTAACTGTAAATTACTAATAAATCTTTTTTGATATTTAAA
Translation
MSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKV - UNI21765 - - UNI29452 - VRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDI

KDLTVCEPPKPQCSLPQDPAIVQ SSLGSSSSSFQSVGSYGPFGRMPAYSQFSPSTLVGQQFGAVGVA - UNI6941 - AGNSLTSFGTEASNSGTLS

QSNAVGSAFTQDTRSVKPQLAQA - UNI12219 - - UNI29680 - AEVHKVPRPENEQLRNDKRQVV - UNI17033 - - UNI29680 - V

PGVPSAPRRGRGGHRGGRGRFGIRRDGPMKFEKDFDFESANAQFNKEEIDREFHNKLKLKE - UNI17033 - - UNI29680 - EDKLEKQEKPVN

GEDKGDSGVDTQNS   
Transcript ENSMUST00000085585
Sequence
GGAGCGGCGGGCGCAGCGCGGGATCTGACTGAGTGCGAGCGGCGGGCGACGGCGGCGGCGCCATGAGCGGGGGCACCCCTTACATCGGCAGCAAGATCAG

CCTCATCTCCAAGGCGGAGATCCGCTACGAGGGCATCCTCTACACCATCGACACCGAGAACTCCACGGTAGCCCTCGCCAAAG - UNI21765 - - U

NI29452 - TTCGATCCTTCGGTACAGAAGACAGACCAACAGATCGTCCAATACCGCCTCGAGATGAAGTCTTTGAATATATTATATTCCGCGGGAGTG

ATATTAAAGACCTCACTGTTTGTGAGCCACCCAAACCACAATGTTCTTTGCCTCAGGACCCGGCTATTGTTCAG TCTTCACTAGGTTCGTCGTCATCTT

CATTCCAGTCGGTGGGTTCCTATGGACCTTTTGGCAGGATGCCAGCATACAGTCAGTTCAGTCCAAGTACATTAGTTGGGCAGCAGTTTGGTGCTGTTGG

TGTTG - UNI6941 - CTGGAAACTCTTTGACATCCTTTGGAACAGAAGCATCAAATAGTGGTACCTTATCCCAGAGCAATGCAGTTGGTTCGGCCTT

CACACAAGACACAAGATCTGTAAAACCACAGCTAGCCCAAG - UNI12219 - GTCGATCAAGCCCTCAGTTAGACCCTTTGAGAAAAAGTCCAACCA

TGGAACAAGCAGTACAGACCGCCTCGGCCCACTTACCTGCTCCAGCACCTGTTGGGAGAAGGAGCCCTGTACCAGCCAGGCCTTTGCCACCTACCAGCCA

GAAAGCAATAGACAACCAAGAGCACAGGCGAG - UNI29680 - CTGAAGTACACAAAGTCCCAAGGCCAGAAAATGAGCAACTCAGAAATGACAAGA

GGCAAGTAG - UNI17033 - - UNI29680 - TTCCTGGAGTTCCTTCTGCTCCAAGAAGAGGACGTGGGGGTCATCGAGGTGGCAGGGGAAGATT

TGGTATCCGTCGAGATGGTCCAATGAAATTTGAGAAAGACTTTGACTTTGAAAGTGCAAATGCACAATTTAACAAGGAGGAAATTGACAGAGAGTTTCAT

AATAAACTTAAACTGAAAG - UNI17033 - - UNI29680 - AAGATAAACTTGAGAAACAAGAGAAACCTGTAAACGGTGAAGACAAAGGAGACT

CAGGAGTCGACACTCAGAACAGTGAAGGGAATGCTGATGAGGAAGATCCCCTTGGGCCCAACTGCTACTATGACAAGACCAAGTCCTTCTTTGACAACAT

CTCTTGTGATGATAATAG AGAAAGGAGACCAACTTGGGCTGAAGAAAGAAGGTTAAATGCTGAAACTTTTGGCATCCCGCTTCGTCCAAACCGTGGCCG

TGGAGGCTACCGAGGCAGAGGAGGCCTTGGCTTCCGTGGTGGCAGAGGGCGTGGTAGTGGCCGAGGAGGAACCTTCACTGCCCCTCGAGGGTTTCGTGCT

GGATTCAGAGGCGCTCGTGGTGGTAGGGAGTTTGCAGACTTTGAATATAGG AAAACCACGGCTTTTGGACCCTAAAAGGTCTGGATTGGTCATACTGCT

TTCTGAAAG AAAGACAACAAAGTTGCTGCATAGTCTACAAACAAGTCTTTGAAAATAGGTGACTCCTAGCTCTTCATGGTCCTGGAAAGTGCTTTCAGT

CTTTGTGAAGAATGAAGAAGTGAAGTTGCTGTCTTGCCTGTCACCAGCACTGGGTTTTGTCTGTTTTCTGCTTCATTTCAAAGCTACACTGCAGTTGCTT

TGGGGCAGGAAGGCTCGTCTTAAAACACAAGTATAAGTGTATGTGGAGTAGCAGATGGTTGTGATTCCTTGTTTAGAGTTGAACTAAAGCCAGCTAAATG

GAACTGCTAAGTATTTTTTCATCACTGAAAGGATTTTCTTATCACTAATTAATTGTATTCGGCAATTACTTCCAATTGCCTGCAGATAGGCCGTGATACT

GTGTTTTGAGCCACAGAAGGTTTTGTGCGTGTGTGTGTGTATGTATGTGTGTGTGCGCGCGCGCGTGTATGTGCGTGTCTTTTTCTTTTTGGAGATCCTA

TAATATGAGGTAGCTTATTTCGACACTTAATTAGGGTGCTGGATGGTAGAGAATTTTGTCAGTCAACTATGTACACACAGGTAAATACTGTTTCTTAGGC

AAAGGTAACTTTTTTATATAGTTGTAAAATTCCATTATATTCCATTGCCAAAGAAACATTAAGAACTTTGTATAGCTGTATAAAAAGCAACTAATTTTTT

AAAGAATAAACGTTTTAAAGTCAGCAAACATACGTGTCCTTGCAGAAGTCAGTGTGCTGAGGAGCAGGGATATGGGTGGGTCTTTCCCCTTGCTTTCCAG

GCTTAAGGTTTTTGATTTCCTTTGTACTGTTTGGACTAAAGTGAAGATTTGATAACTTTATTCCATTATCTAAAAAGCATAAATTATTCATGCATAGTGT

ATGGACTTCGTTTTGTAGCAAATCACAGGATTTGTTCAAATAACAGATCTTTTAAGTGTATGAATGTAAATAATCATAGATGAGAGTGTACCTCGCTGTA

TTTTCAAATAAGTAACCTTTTTAAGACATTAAAACTCAATATATCAGTTGACCCATTCCTCCTGCTATGCCTGGAATTCTGTTGTGGTAACCGCTGACTC

CTGTTTTATGTCAAAAAGATGGAGTTTTCAGAATCCTCTGGCACCTGTAAAACATCACTAACATAGTATGCGGGCCTGTGGCCTTCTAATGACTCTGTAC

ACGGTTGTTGCTAACTGTAAATTACTAATAAATCTTTTTTGATATTTAAA
Translation
MSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKV - UNI21765 - - UNI29452 - VRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDI

KDLTVCEPPKPQCSLPQDPAIVQ SSLGSSSSSFQSVGSYGPFGRMPAYSQFSPSTLVGQQFGAVGVA - UNI6941 - AGNSLTSFGTEASNSGTLS

QSNAVGSAFTQDTRSVKPQLAQG - UNI12219 - GRSSPQLDPLRKSPTMEQAVQTASAHLPAPAPVGRRSPVPARPLPPTSQKAIDNQEHRRA - 

UNI29680 - AEVHKVPRPENEQLRNDKRQVV - UNI17033 - - UNI29680 - VPGVPSAPRRGRGGHRGGRGRFGIRRDGPMKFEKDFDFES

ANAQFNKEEIDREFHNKLKLKE - UNI17033 - - UNI29680 - EDKLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDN

ISCDDNR RERRPTWAEERRLNAETFGIPLRPNRGRGGYRGRGGLGFRGGRGRGSGRGGTFTAPRGFRAGFRGARGGREFADFEYR KTTAFGP 

For any suggestions or comments, please send an email to unitrap@crg.es