Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000066571 (4931406P16Rik)
Chromosomal location
Chr 7: 35021726 - 35098570 (-)
Description
RIKEN cDNA 4931406P16 gene Gene [Source:MGI Symbol;Acc:MGI:1924311]
RefSeq_dna
NM_172741 
RefSeq_peptide
NP_766329.1 
UniGene
Mm.387835 
MGI
MGI:1924311 
Uniprot/SPTREMBL
Q3UYG5 Q3TDH2 Q6PAL5 Q6ZQD1 Q8C5X1 
Human Ortholog
ENSG00000166398 (KIAA0355)
Omim not available
UniTrap UNI24232
Vector Insertion
Chr 7: 35070973 - 35098510
Public Clones (sanger) 3SE053D12 (ggtc) IST14436A10 (tigm) IST14990D2 (tigm) IST14548B5 (tigm)
Private Clones OST230345 (lexicon) OST227138 (lexicon) OST227004 (lexicon) OST226338 (lexicon)
OST226274 (lexicon) OST224118 (lexicon) OST222837 (lexicon) OST222830 (lexicon)
OST86087 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32525
Vector Insertion
Chr 7: 35048571 - 35070619
Public Clones IST14865E5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13071
Vector Insertion
Chr 7: 35033252 - 35039005
Public Clones CMHD-GT_344A4-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16580
Vector Insertion
Chr 7: 35030998 - 35033125
Public Clones not available
Private Clones OST457873 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27625
Vector Insertion
Chr 7: 35027425 - 35029984
Public Clones not available
Private Clones OST55050 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23929
Vector Insertion
Chr 7: 35024842 - 35025527
Public Clones not available
Private Clones OST240261 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108073
Sequence
ACTTCCGGTGTACACAGCCGGTCCGGGCGGTGCGCCGGAGCCGGGGCGCTTCGCAG - UNI24232 - GAAATGACTTAGAGGCCTTATGAATACATC

TGTGCTTTCTTGCTTCAGACTTTACAACTGCAGGCCAACCCAGTCTGGAAGCACTTTTTATTAATGTTACAAGGAAACCGCTACCTCAGCAAACAAAAGA

AAGGAGAAGACACACAATAACAAATGCCATGTTTAAAGAAAACTTGTTCCCAGAAACCTTTACAGGAGATTTGGAAGTTTTTAGCACTGAGAAGCAGCTT

TCCAGGTAAATGGATTTGACAGGCAGGCTCTGTCAGAATTCTGCAGAGGTGTGTTCTTCCTTCAGGACTTCTTGTGAAGTAACCCCTTCCGCCTAAATGC

TGTTGACCAGCTGGGGTCCTTTTTGGTATATAGAAGATACATTATATTACATTTTAAAAGTTAAGTTATTTTTCTGCCATTGTAAATGTAAGTATCAAAA

TATTCTTGCAAAGCAATTATAAGCAAACACTTTCCTCAGCAAGCATATCTTCATTGAGGGTAGGATGCTGAACAGTTACAGAGCATTTCGGACACTGTTA

TTTTTTTGTTAGAGTTCCTGCCTACACTGAAAATATTAATTATATAAATCTGTTATTTTTCTCACCTTTATGTTGGATCACATGGTCACCTGCCTCATGG

AAATGCCTTTTTTAAAACTTAGATTTGCAGAACTCCACTATTTTTATACCTAGCTACAGTTTTGGAAAAAAAAAAAGGACTCAGAACCCTGACCTGCCAG

TGGTCCCCGGGACAGTTCCCCACCCGTATGTATTGCTGCAGTGCCCAGGACAATAAGATGGACTACAAGCGGCGCTTCCTGCTTGGCGGGTCCAAGCAGA

AGGTGCAGCAGCACCAGCAGTACCCGATGCCTGAGCTGGGCCGAGCACTGAGCGCTCCCCTGGCATCCACCGCCCCCTCTGCCCCGCTGGGCAGTCTGAC

CGCTGCAGGCAGCTGCCACCATGCCATGCCCCACTCTACTCCCATTGCTGACATCCAGCAGGGCATCTCTAAGTACCTGGATGCCCTCAATGTCTTTTGC

CGTGCTAGTACGTTCCTCACAGATCTCTTCAGCACCGTGTTCAGGAACTCACACTACTCAAAGGCCGCCATGCAGCTCAAAGATGTGCAGGAACATGTAA

TGGAAGCAGCCAGCAGATTGACCTCAGCCATAAAGCCCGAGATTGCCAAGATGCTCATGGAACTCAGTGCTGGGGCTGCAAACTTCACAGATCAGAAGGA

ATTCAGTCTCCAGGACATTGAGGTAAAGTACTGTCATCATAGGAAAATGGACTGCAAATGTCACCGAGGATACTCAGTTTCTCCAAATTGTGGCAGTAAT

AGCCTTTGTCCTCCTTCTGTTGATATACTCTTCTTGTAAAAAGTTTGGTGCCTGCCAAGTTCTGATGCTTTCATTTGAAGTAAGTTAAATGATTATCGAG

AAGGATGAGAAAGCTCAGTGCTAGAGTCAGTGTTCAGGGTGTGAGATCTCAGGAACAACCCAGCACACACCGAAGAAAAAGTTAAACTGATTGTGTTTGA

TGTTTGCCCTTCATTTTCTCAAATTGGAAACTAGTATCCAAATAATAATCTATGAAAAGTAGGTAGTGAAGGACTGGAGATACACTACAGTGCCCTTGCC

TACACATAAAGTCCTAGCTACAATCCCTAATACTGCACAAACAGAAGTGCTTAGAATTCTAAGTATAATCATGAATCGTATTTTTCAATTTTCAGTCTAT

AGAATCACTGGTTTATAAGAAAGTCCCATGTGTTTATAGAATAAGCTAGTTTTCCAGTTCTAAATCGAAAACTTTTTTCCATCAAAATGCATTTGAAGCT

TACTCAGTGTATTTCTTGGGTAGTGTAGTAAAAATGAAACACTCTTCTTTAGGACTCTAGATTAGAATCAAGTTTTATTCAGAGTAAAGATGGCTTTTTT

GCCCCCCTGACTTCCTTTATTGAGGAAATAATATTTTTTAAGATTTATTTATTTCCTCG
Translation
 - UNI24232 - MYCCSAQDNKMDYKRRFLLGGSKQKVQQHQQYPMPELGRALSAPLASTAPSAPLGSLTAAGSCHHAMPHSTPIADIQQGISKYLDA

LNVFCRASTFLTDLFSTVFRNSHYSKAAMQLKDVQEHVMEAASRLTSAIKPEIAKMLMELSAGAANFTDQKEFSLQDIEVKYCHHRKMDCKCHRGYSVSP

NCGSNSLCPPSVDILFL
Transcript ENSMUST00000108074
Sequence
CGTCACTTCCGGTGTACACAGCCGGTCCGGGCGGTGCGCCGGAGCCGGGGCGCTTCGCAGGTGAG - UNI24232 - GAAATGACTTAGAGGCCTTAT

GAATACATCTGTGCTTTCTTGCTTCAGACTTTACAACTGCAGGCCAACCCAGTCTGGAAGCACTTTTTATTAATGTTACAAGGAAACCGCTACCTCAGCA

AACAAAAGAAAGGAGAAGACACACAATAACAAATGCCATGTTTAAAGAAAACTTGTTCCCAGAAACCTTTACAGGAGATTTGGAAGTTTTTAGCACTGAG

AAGCAGCTTTCCAGGTAAATGGATTTGACAGGCAGGCTCTGTCAGAATTCTGCAGAGGTGTGTTCTTCCTTCAGGACTTCTTGTGAAGTAACCCCTTCCG

CCTAAATGCTGTTGACCAGCTGGGGTCCTTTTTGGTATATAGAAGATACATTATATTACATTTTAAAAGTTAAGTTATTTTTCTGCCATTGTAAATGTAA

GTATCAAAATATTCTTGCAAAGCAATTATAAGCAAACACTTTCCTCAGCAAGCATATCTTCATTGAGGGTAGGATGCTGAACAGTTACAGAGCATTTCGG

ACACTGTTATTTTTTTGTTAGAGTTCCTGCCTACACTGAAAATATTAATTATATAAATCTGTTATTTTTCTCACCTTTATGTTGGATCACATGGTCACCT

GCCTCATGGAAATGCCTTTTTTAAAACTTAGATTTGCAGAACTCCACTATTTTTATACCTAGCTACAGTTTTGGAAAAAAAAAAAGGACTCAGAACCCTG

ACCTGCCAGTGGTCCCCGGGACAGTTCCCCACCCGTATGTATTGCTGCAGTGCCCAGGACAATAAGATGGACTACAAGCGGCGCTTCCTGCTTGGCGGGT

CCAAGCAGAAGGTGCAGCAGCACCAGCAGTACCCGATGCCTGAGCTGGGCCGAGCACTGAGCGCTCCCCTGGCATCCACCGCCCCCTCTGCCCCGCTGGG

CAGTCTGACCGCTGCAGGCAGCTGCCACCATGCCATGCCCCACTCTACTCCCATTGCTGACATCCAGCAGGGCATCTCTAAGTACCTGGATGCCCTCAAT

GTCTTTTGCCGTGCTAGTACGTTCCTCACAGATCTCTTCAGCACCGTGTTCAGGAACTCACACTACTCAAAGGCCGCCATGCAGCTCAAAGATGTGCAGG

AACATGTAATGGAAGCAGCCAGCAGATTGACCTCAGCCATAAAGCCCGAGATTGCCAAGATGCTCATGGAACTCAGTGCTGGGGCTGCAAACTTCACAGA

TCAGAAGGAATTCAGTCTCCAGGACATTGAG - UNI32525 - GTGTTGGGGCGATGTTTCTTGACAGTGGTGCAAGTCCATTTCCAGTTTTTGACCC

ACGCCTTGCAGAAAGTCCAGCCGGTGGCTCACTCTTGCTTTGCTGAGGTAGTTGTGCCAGAAAAAAAGAACAGCAGTCTGTCTGGCATGGGCCACACACC

TGAACTGGAGGAAGCTGTGCGATCCTGGCGAGGGGCAGCTGAG - UNI32525 - GCGACATCTAGATTGAGAGAGAGAGGCTGTGATGGATGCCTGG

CAGGAATCGAAGTCCAACAACTCTTTTGTTCTCAAAGTGCAGCAATTCCTGAGCACCAGCTAAAAGAGCTAAACATAAAAATCGACAGTGCTTTGCAG G

CTTATAAAATAGCTTTGGAAAGCTTAGGCCACTGTGAATATGCAATGAAAGCTGGCTTCCATCTAAACCCAAAGGCCATTGAAGCAAGTTTGCAG GGCT

GCTGCAGTGAGGCGGAAGCTCAGCAGACAGGGCGAAGGCAGACACCCCCACAGCCCATGCAGTGTGAGCTCCCCACGGTTCCTGTGCAGATAGGATCGCA

CTTCCTGAAGGGGGTCTCCTTTAATGAGTCGGCTGCCGACAATCTGAAGCTTAAGACG CATACCATGTTACAGCTCATCAAGGAAGCAGGCTGCTACAA

TGGAATCACACCTAGGGATGATCTTCCTGTGACTGAAGTCCTGAATCAGGTGTGCCCGTCCATGTGGCGGGGTGCCTGTAAGACTGCTGTGCAGCTGCTG

TTCGGCCAGGCAGGGCTG GTGGTTGTTGACACAGCACAGATTGAAAATAAAGAAGCCTATGCACCCCAGATCAGTCTTGAAGGTTCCAGAATTGTGGTT

CAAGTCCCATCCACATG - UNI13071 - GTGCTTAAAGGAAGATCCTGCTACCATGTCCCTGCTGCAGAGGAGCCTGGATCCCGAGAAGACCCTAGG

TCTGGTGGATGTGCTTTACACAGCCGTGCTAGACCTAAACCGCTGGAGAACAGGGAG - UNI16580 - GGAACAAGCTTTACCCTGTATACAGATCC

AGCTGCAAAGGGATATCTGCGATTTTGGGAATCAGGCTGACCTGCCTTCTGGAAATGGAAGCAAATCCTCGGGACTGCAGAAGACTTTCTCCAAACTGAC

ATCCCGGTTCACAAAGAAAGTGTCATGCACCAACTCTGGCAGCACACACTATTCCAAAAACATCTTCACAGCTGGGTGTTCAGAGGAAAGGGCCAAAATG

ATGGGCAATAATATTGATACACGGTTACAGAGCATTTTGAACATTGGTAACTTCCCTAGGACTACAGACCCTTCACAGTCGTCTCAGAATTCCAGTAATC

CAATGGTCAATGGCTTTCTCCTGGAGAGACGTGAGAACTTCCTGCATGGGGATGATGGCAAGGATGAGAAGGGCATGAACTTACCCACTGATCAGGAAAT

GCAGGAAGTGATAGATTTTCTCTCAGGCTTTAACATGGGCCAGTCCCATCAGGGGTCCCCACTGGTGACAAGGCGTAACTCTACTGCCACTGCCATGGTG

ACTGAACAGAAGACAGGAACCATGCAACCACAGCAGCCATCACTGCCATTGGCTCCTCCACTACGGCCACCCCAGGCTGGAGCACACACGCCTCTGGCAG

CCCAGCAAGGTCTGGCTCCTCAGCAGCAGTCTCCAAAGCAGCAGCAGCCCCAAGTCCAGTACTACCAGCACCTGCTGCAACCCATTGGATCACAGCAGAC

TCCACCTCAGCCTCGGGCGCCTGCGAAATGGGTACATGGCTCATCTCAGCACCCATCACAGCCCATGGCAGCGGGTCTGTCTCCTCTTGGTCAGTGGCCT

GGCATATCTGATCTCAGCTCTGACTTGTACAGCTTGGGTCTAGTGAGCAGCTATATGGACAATATGATGTCAGAAGTTTTGGGACAGAAGCCCCAGGGAC

CTAGAAATAACACCTGGCCAAACCGTGACCAAAGTGATGGAGTCTTTGGAATGCTGGGAGAGATTTTGCCTTTTGATCCTGCAG - UNI27625 - TG

GGCTCAGACCCAGAATTCGCACGCTATGTGGCAGGAGTGAGCCAGGCAATGCAGCAGAAGCGGCAAGCTCAACATGGCCGCCGGCCAGGCAACCCCCGTG

GCAACTGGCCGCCCATGGAAGACGCTCATCGGACCTGGCCTTTGCCAGAGTTCTTCACAGAAGG GGACAGCTTGCACAGCGGCTGGTCAGGAGCTCAGG

GAGACTCGGCCAGTTCCAGTGATGAGACCTCTTCAGCCAATGGGGACAGTCTGTTCTCCATGTTTTCAGGGCCTGACCTTGTTGCTGCTGTTAAACAGAG

AAG - UNI23929 - GAAACACAGCAGTGGAGAGCAGGAGACCAGCACACTGCCCTCACCACCTCTCCTGACCACAGTGGAGGACGTGAACCAG GAT

AACAAAACCAAAACGTGGCCACCCAAAGCACCATGGCAGCACCCTTCCCCGATGCCCAGCACGCTGCCCAGCCCAGCTGCACCACTCTATGCAGTCGCCA

GTCCTGGCAGCCAGTGGAACGACACCGTGCAGATGCTGCAGTCCCCTGTGTGGGCTGCAGCCAATGACTGCAATACCACCTCCTTCACCTATGTTCAGAC

ACCACCACAGCCCCCACCTCCACCAGCACATAAGGCAGCACCCAAGGGCTTCAAGGCCTTCCCTGGGAAGGCTGAACGTAGGCCAGCCTATTTGCCCCAG

TACTGACTACAGCTAGCCTGCTGCCCATCAAAGCTGTTGGGGCAACTGTCCCCAAGGCTAACTAGCTGATACTAGCCCCCAGAAGGACCAGTACACCCTG

TCCCAGGGACAGAAATATTCCTTGGGTCTGAGGTGATTGGCAGCTCCAAGTCTTTAAAGCCTGGTTTCTCAAACTTTGAAGGTAGCAGACCCCTGAGAGC

CAGCTGAAGATGGAGATTTCTGACACTCAGGGGATGCTGGCAATCTGCATGCTTAATAAGCACCTCAGGTAATCCTGGTGCAGGTGGCCAGAGGCCACAC

TTGGGAAAACACAGTCTGAAGGTAGTCCTGCATGTGGGAAAGGCATGAGGCCTGCAGGCTGAGAACAAAACTGACCATTCTTTGAAACTCTTCTCTTTAA

CACACTGAGTGGGACCCACACCCATCACTAATTTTATAGATATTTTTCATGTAGGCTTTCGGTTAAAACGTCTCCTGCCTAAAATGCAGTGGCTATCTTA

AGATCCAGGTACACTGGCTGAAGGTTAGTTAGCTCAGCACTGTCTTCATTTAAGCTTATATAAGATGCTAGTGATCAGAAGCAACCACCTGGCTTCCCAT

GGGTCAGTAGCTCCTCTGAAGCACCCAGGGGTGCAGGCTCATGTAATGTACAAGAGCGGGATTGGGCAACTGCTGTCAGGCATATTCTGGCCTCCCAGGG

GGTGCAGCTGGTGCATGCTGAGTGCACCTGCTGCCCTCACTTCCTTCCACCATGACCAGGGCAGCACCAGCACCACGCTCCTCTACGGAAGGAACTGTGG

AGGGGAGGGGTTGCACCAAGACCCCCACACTCAGAACCACAGTGACATTGTGAGCTGACTCAGAGACAAAGGAATTATGATGTAGACAGGAATTCAAAAT

CTTTGTTTAGTCACCAACAACACCTCACTTTTAGTTAATGTGTGCCATTAAACAGATGACACTCCATGGATTTGGGGATATTTTCCAGCTAGAATGGATC

CAGAATTGAATGGTGCTTAAATTGAGAAATAATAAATATATCTATATAGAGTAGACATTTCCCACTATATATTAATTGAGGTTGCAGAAGGTTCTTTATA

TAAAACTTATTTAAAATTTTCATATTTCATCTTTGAAAATGTCTAATTGAGAAAAATCCATGATATTTTCTGGTATGAAAGTTTGACAGTATTAATTTTT

TTATATTTTCTTAAATCATTAAACCATTTTAATATATGTTAACTACTAATAAATGGTTTATTCTTTCTAACTCCATGTAAGCTTTTCCAATGAAGATTGT

AATAACACATTTTTGTTCTCATTTTTCTACAGATAAATTTATATTTAAAAATACCAAAAAAAAAAATCCCTATGTATACACACCACACACATACACACAC

ACAGACACACATTCACTTATAAGAAAATTATAGAGGACCTGTAGGGTGAGCCCAGCCACCTGCGTTTTTAGTACTGTGTCTCCAGGCTGCCTGAGGCCTC

AGCTGTTGTCATTCGTGCTGTGTGGGGGTGACATTTCTGCCTGTAGTGAAGATCCTTCTCAGTGGGTTCGGAATATTCACCTCACCATGTTTACAGAGAA

CTATTTTGTACATAGAGTTTTCCAGGCACGTACTTTGCACCAGCCCTGCGTGGCTGTTGTCTGTGTTAGCTGTCACAGTGTGCACACTAATCTGTTCAGA

GTTCCTTGTGGCTGTTTGACTTGTAAAAACTGTGTATTTCCTTCAGTAATGTGTCCACAGTGCTGTGTTTCCAGTTCTAGTCTTCTGCAGTACTCTCATT

TTCATAGTGCCTCCCTGAAGACCTCACCTTGGGCCAAGGTCACTCCTCGGTGCCACAGCACAGGTGACACTGCTAATTGTCATCTCTGGTCTGTCTTTCT

CTATTAAGGAAGATATTTGTCTCCACGGCTGTGTGACCGTGTGAATCAGCTTGTGTAGTCTCCACATGGGTGCTGTTCGAAGCACCACCTTGCTCTAAAC

ACTGGTGATTCCAGGTGCTGCGCTTGGCAGAGGTGTCTTGCCAAAGCGCATGTATGCGTGTGAGTGTGTCCTCAGCACGGCCAAGCATGGCTGCCTTGCT

CGGCATTAGCAGGACATCATGTGAATAGTTGTGACCTTCCAAAACTGGAACTCTACATTTTGTATCTTACTTTTAAAGCTCCTATAAGTAAAATAACTTG

GCTTTATTAAAATATACATTTAATAATA
Translation
 - UNI24232 - MYCCSAQDNKMDYKRRFLLGGSKQKVQQHQQYPMPELGRALSAPLASTAPSAPLGSLTAAGSCHHAMPHSTPIADIQQGISKYLDA

LNVFCRASTFLTDLFSTVFRNSHYSKAAMQLKDVQEHVMEAASRLTSAIKPEIAKMLMELSAGAANFTDQKEFSLQDIE - UNI32525 - VLGRCFL

TVVQVHFQFLTHALQKVQPVAHSCFAEVVVPEKKNSSLSGMGHTPELEEAVRSWRGAAE - UNI32525 - ATSRLRERGCDGCLAGIEVQQLFCSQS

AAIPEHQLKELNIKIDSALQ AYKIALESLGHCEYAMKAGFHLNPKAIEASLQ GCCSEAEAQQTGRRQTPPQPMQCELPTVPVQIGSHFLKGVSFNESA

ADNLKLKT HTMLQLIKEAGCYNGITPRDDLPVTEVLNQVCPSMWRGACKTAVQLLFGQAGL VVVDTAQIENKEAYAPQISLEGSRIVVQVPSTW - U

NI13071 - WCLKEDPATMSLLQRSLDPEKTLGLVDVLYTAVLDLNRWRTGR - UNI16580 - REQALPCIQIQLQRDICDFGNQADLPSGNGSKS

SGLQKTFSKLTSRFTKKVSCTNSGSTHYSKNIFTAGCSEERAKMMGNNIDTRLQSILNIGNFPRTTDPSQSSQNSSNPMVNGFLLERRENFLHGDDGKDE

KGMNLPTDQEMQEVIDFLSGFNMGQSHQGSPLVTRRNSTATAMVTEQKTGTMQPQQPSLPLAPPLRPPQAGAHTPLAAQQGLAPQQQSPKQQQPQVQYYQ

HLLQPIGSQQTPPQPRAPAKWVHGSSQHPSQPMAAGLSPLGQWPGISDLSSDLYSLGLVSSYMDNMMSEVLGQKPQGPRNNTWPNRDQSDGVFGMLGEIL

PFDPAV - UNI27625 - VGSDPEFARYVAGVSQAMQQKRQAQHGRRPGNPRGNWPPMEDAHRTWPLPEFFTEG GDSLHSGWSGAQGDSASSSDETS

SANGDSLFSMFSGPDLVAAVKQRR - UNI23929 - RKHSSGEQETSTLPSPPLLTTVEDVNQ DNKTKTWPPKAPWQHPSPMPSTLPSPAAPLYAVA

SPGSQWNDTVQMLQSPVWAAANDCNTTSFTYVQTPPQPPPPPAHKAAPKGFKAFPGKAERRPAYLPQY
Transcript ENSMUST00000085592
Sequence
GGTATATAGAAGATACATTATATTACATTTTAAAAGTTAAGTTATTTTTCTGCCATTGTAAATGTAAGTATCAAAATATTCTTGCAAAGCAATTATAAGC

AAACACTTTCCTCAGCAAGCATATCTTCATTGAGGGTAGGATGCTGAACAGTTACAGAGCATTTCGGACACTGTTATTTTTTTGTTAGAGTTCCTGCCTA

CACTGAAAATATTAATTATATAAATCTGTTATTTTTCTCACCTTTATGTTGGATCACATGGTCACCTGCCTCATGGAAATGCCTTTTTTAAAACTTAGAT

TTGCAGAACTCCACTATTTTTATACCTAGCTACAGTTTTGGAAAAAAAAAAAGGACTCAGAACCCTGACCTGCCAGTGGTCCCCGGGACAGTTCCCCACC

CGTATGTATTGCTGCAGTGCCCAGGACAATAAGATGGACTACAAGCGGCGCTTCCTGCTTGGCGGGTCCAAGCAGAAGGTGCAGCAGCACCAGCAGTACC

CGATGCCTGAGCTGGGCCGAGCACTGAGCGCTCCCCTGGCATCCACCGCCCCCTCTGCCCCGCTGGGCAGTCTGACCGCTGCAGGCAGCTGCCACCATGC

CATGCCCCACTCTACTCCCATTGCTGACATCCAGCAGGGCATCTCTAAGTACCTGGATGCCCTCAATGTCTTTTGCCGTGCTAGTACGTTCCTCACAGAT

CTCTTCAGCACCGTGTTCAGGAACTCACACTACTCAAAGGCCGCCATGCAGCTCAAAGATGTGCAGGAACATGTAATGGAAGCAGCCAGCAGATTGACCT

CAGCCATAAAGCCCGAGATTGCCAAGATGCTCATGGAACTCAGTGCTGGGGCTGCAAACTTCACAGATCAGAAGGAATTCAGTCTCCAGGACATTGAG -

 UNI32525 - GTGTTGGGGCGATGTTTCTTGACAGTGGTGCAAGTCCATTTCCAGTTTTTGACCCACGCCTTGCAGAAAGTCCAGCCGGTGGCTCACT

CTTGCTTTGCTGAGGTAGTTGTGCCAGAAAAAAAGAACAGCAGTCTGTCTGGCATGGGCCACACACCTGAACTGGAGGAAGCTGTGCGATCCTGGCGAGG

GGCAGCTGAG - UNI32525 - GCGACATCTAGATTGAGAGAGAGAGGCTGTGATGGATGCCTGGCAGGAATCGAAGTCCAACAACTCTTTTGTTCTC

AAAGTGCAGCAATTCCTGAGCACCAGCTAAAAGAGCTAAACATAAAAATCGACAGTGCTTTGCAG GCTTATAAAATAGCTTTGGAAAGCTTAGGCCACT

GTGAATATGCAATGAAAGCTGGCTTCCATCTAAACCCAAAGGCCATTGAAGCAAGTTTGCAG GGCTGCTGCAGTGAGGCGGAAGCTCAGCAGACAGGGC

GAAGGCAGACACCCCCACAGCCCATGCAGTGTGAGCTCCCCACGGTTCCTGTGCAGATAGGATCGCACTTCCTGAAGGGGGTCTCCTTTAATGAGTCGGC

TGCCGACAATCTGAAGCTTAAGACG CATACCATGTTACAGCTCATCAAGGAAGCAGGCTGCTACAATGGAATCACACCTAGGGATGATCTTCCTGTGAC

TGAAGTCCTGAATCAGGTGTGCCCGTCCATGTGGCGGGGTGCCTGTAAGACTGCTGTGCAGCTGCTGTTCGGCCAGGCAGGGCTG GTGGTTGTTGACAC

AGCACAGATTGAAAATAAAGAAGCCTATGCACCCCAGATCAGTCTTGAAGGTTCCAGAATTGTGGTTCAAGTCCCATCCACATG - UNI13071 - GT

GCTTAAAGGAAGATCCTGCTACCATGTCCCTGCTGCAGAGGAGCCTGGATCCCGAGAAGACCCTAGGTCTGGTGGATGTGCTTTACACAGCCGTGCTAGA

CCTAAACCGCTGGAGAACAGGGAG - UNI16580 - GGAACAAGCTTTACCCTGTATACAGATCCAGCTGCAAAGGGATATCTGCGATTTTGGGAATC

AGGCTGACCTGCCTTCTGGAAATGGAAGCAAATCCTCGGGACTGCAGAAGACTTTCTCCAAACTGACATCCCGGTTCACAAAGAAAGTGTCATGCACCAA

CTCTGGCAGCACACACTATTCCAAAAACATCTTCACAGCTGGGTGTTCAGAGGAAAGGGCCAAAATGATGGGCAATAATATTGATACACGGTTACAGAGC

ATTTTGAACATTGGTAACTTCCCTAGGACTACAGACCCTTCACAGTCGTCTCAGAATTCCAGTAATCCAATGGTCAATGGCTTTCTCCTGGAGAGACGTG

AGAACTTCCTGCATGGGGATGATGGCAAGGATGAGAAGGGCATGAACTTACCCACTGATCAGGAAATGCAGGAAGTGATAGATTTTCTCTCAGGCTTTAA

CATGGGCCAGTCCCATCAGGGGTCCCCACTGGTGACAAGGCGTAACTCTACTGCCACTGCCATGGTGACTGAACAGAAGACAGGAACCATGCAACCACAG

CAGCCATCACTGCCATTGGCTCCTCCACTACGGCCACCCCAGGCTGGAGCACACACGCCTCTGGCAGCCCAGCAAGGTCTGGCTCCTCAGCAGCAGTCTC

CAAAGCAGCAGCAGCCCCAAGTCCAGTACTACCAGCACCTGCTGCAACCCATTGGATCACAGCAGACTCCACCTCAGCCTCGGGCGCCTGCGAAATGGGT

ACATGGCTCATCTCAGCACCCATCACAGCCCATGGCAGCGGGTCTGTCTCCTCTTGGTCAGTGGCCTGGCATATCTGATCTCAGCTCTGACTTGTACAGC

TTGGGTCTAGTGAGCAGCTATATGGACAATATGATGTCAGAAGTTTTGGGACAGAAGCCCCAGGGACCTAGAAATAACACCTGGCCAAACCGTGACCAAA

GTGATGGAGTCTTTGGAATGCTGGGAGAGATTTTGCCTTTTGATCCTGCAG - UNI27625 - TGGGCTCAGACCCAGAATTCGCACGCTATGTGGCA

GGAGTGAGCCAGGCAATGCAGCAGAAGCGGCAAGCTCAACATGGCCGCCGGCCAGGCAACCCCCGTGGCAACTGGCCGCCCATGGAAGACGCTCATCGGA

CCTGGCCTTTGCCAGAGTTCTTCACAGAAGG GGACAGCTTGCACAGCGGCTGGTCAGGAGCTCAGGGAGACTCGGCCAGTTCCAGTGATGAGACCTCTT

CAGCCAATGGGGACAGTCTGTTCTCCATGTTTTCAGGGCCTGACCTTGTTGCTGCTGTTAAACAGAGAAG - UNI23929 - GAAACACAGCAGTGGA

GAGCAGGAGACCAGCACACTGCCCTCACCACCTCTCCTGACCACAGTGGAGGACGTGAACCAG GATAACAAAACCAAAACGTGGCCACCCAAAGCACCA

TGGCAGCACCCTTCCCCGATGCCCAGCACGCTGCCCAGCCCAGCTGCACCACTCTATGCAGTCGCCAGTCCTGGCAGCCAGTGGAACGACACCGTGCAGA

TGCTGCAGTCCCCTGTGTGGGCTGCAGCCAATGACTGCAATACCACCTCCTTCACCTATGTTCAGACACCACCACAGCCCCCACCTCCACCAGCACATAA

GGCAGCACCCAAGGGCTTCAAGGCCTTCCCTGGGAAGGCTGAACGTAGGCCAGCCTATTTGCCCCAGTACTGACTACAGCTAGCCTGCTGCCCATCAAAG

CTGTTGGGGCAACTGTCCCCAAGGCTAACTAGCTGATACTAGCCCCCAGAAGGACCAGTACACCCTGTCCCAGGGACAGAAATATTCCTTGGGTCTGAGG

TGATTGGCAGCTCCAAGTCTTTAAAGCCTGGTTTCTCAAACTTTGAAGGTAGCAGACCCCTGAGAGCCAGCTGAAGATGGAGATTTCTGACACTCAGGGG

ATGCTGGCAATCTGCATGCTTAATAAGCACCTCAGGTAATCCTGGTGCAGGTGGCCAGAGGCCACACTTGGGAAAACACAGTCTGAAGGTAGTCCTGCAT

GTGGGAAAGGCATGAGGCCTGCAGGCTGAGAACAAAACTGACCATTCTTTGAAACTCTTCTCTTTAACACACTGAGTGGGACCCACACCCATCACTAATT

TTATAGATATTTTTCATGTAGGCTTTCGGTTAAAACGTCTCCTGCCTAAAATGCAGTGGCTATCTTAAGATCCAGGTACACTGGCTGAAGGTTAGTTAGC

TCAGCACTGTCTTCATTTAAGCTTATATAAGATGCTAGTGATCAGAAGCAACCACCTGGCTTCCCATGGGTCAGTAGCTCCTCTGAAGCACCCAGGGGTG

CAGGCTCATGTAATGTACAAGAGCGGGATTGGGCAACTGCTGTCAGGCATATTCTGGCCTCCCAGGGGGTGCAGCTGGTGCATGCTGAGTGCACCTGCTG

CCCTCACTTCCTTCCACCATGACCAGGGCAGCACCAGCACCACGCTCCTCTACGGAAGGAACTGTGGAGGGGAGGGGTTGCACCAAGACCCCCACACTCA

GAACCACAGTGACATTGTGAGCTGACTCAGAGACAAAGGAATTATGATGTAGACAGGAATTCAAAATCTTTGTTTAGTCACCAACAACACCTCACTTTTA

GTTAATGTGTGCCATTAAACAGATGACACTCCATGGATTTGGGGATATTTTCCAGCTAGAATGGATCCAGAATTGAATGGTGCTTAAATTGAGAAATAAT

AAATATATCTATATAGAGTAGACATTTCCCACTATATATTAATTGAGGTTGCAGAAGGTTCTTTATATAAAACTTATTTAAAATTTTCATATTTCATCTT

TGAAAATGTCTAATTGAGAAAAATCCATGATATTTTCTGGTATGAAAGTTTGACAGTATTAATTTTTTTATATTTTCTTAAATCATTAAACCATTTTAAT

ATATGTTAACTACTAATAAATGGTTTATTCTTTCTAACTCCATGTAAGCTTTTCCAATGAAGATTGTAATAACACATTTTTGTTCTCATTTTTCTACAGA

TAAATTTATATTTAAAAATACCAAAAAAAAAAATCCCTATGTATACACACCACACACATACACACACACAGACACACATTCACTTATAAGAAAATTATAG

AGGACCTGTAGGGTGAGCCCAGCCACCTGCGTTTTTAGTACTGTGTCTCCAGGCTGCCTGAGGCCTCAGCTGTTGTCATTCGTGCTGTGTGGGGGTGACA

TTTCTGCCTGTAGTGAAGATCCTTCTCAGTGGGTTCGGAATATTCACCTCACCATGTTTACAGAGAACTATTTTGTACATAGAGTTTTCCAGGCACGTAC

TTTGCACCAGCCCTGCGTGGCTGTTGTCTGTGTTAGCTGTCACAGTGTGCACACTAATCTGTTCAGAGTTCCTTGTGGCTGTTTGACTTGTAAAAACTGT

GTATTTCCTTCAGTAATGTGTCCACAGTGCTGTGTTTCCAGTTCTAGTCTTCTGCAGTACTCTCATTTTCATAGTGCCTCCCTGAAGACCTCACCTTGGG

CCAAGGTCACTCCTCGGTGCCACAGCACAGGTGACACTGCTAATTGTCATCTCTGGTCTGTCTTTCTCTATTAAGGAAGATATTTGTCTCCACGGCTGTG

TGACCGTGTGAATCAGCTTGTGTAGTCTCCACATGGGTGCTGTTCGAAGCACCACCTTGCTCTAAACACTGGTGATTCCAGGTGCTGCGCTTGGCAGAGG

TGTCTTGCCAAAGCGCATGTATGCGTGTGAGTGTGTCCTCAGCACGGCCAAGCATGGCTGCCTTGCTCGGCATTAGCAGGACATCATGTGAATAGTTGTG

ACCTTCCAAAACTGGAACTCTACATTTTGTATCTTACTTTTAAAGCTCCTATAAGTAAAATAACTTGGCTTTATTAAAATATACATTT
Translation
MYCCSAQDNKMDYKRRFLLGGSKQKVQQHQQYPMPELGRALSAPLASTAPSAPLGSLTAAGSCHHAMPHSTPIADIQQGISKYLDALNVFCRASTFLTDL

FSTVFRNSHYSKAAMQLKDVQEHVMEAASRLTSAIKPEIAKMLMELSAGAANFTDQKEFSLQDIE - UNI32525 - VLGRCFLTVVQVHFQFLTHAL

QKVQPVAHSCFAEVVVPEKKNSSLSGMGHTPELEEAVRSWRGAAE - UNI32525 - ATSRLRERGCDGCLAGIEVQQLFCSQSAAIPEHQLKELNIK

IDSALQ AYKIALESLGHCEYAMKAGFHLNPKAIEASLQ GCCSEAEAQQTGRRQTPPQPMQCELPTVPVQIGSHFLKGVSFNESAADNLKLKT HTMLQ

LIKEAGCYNGITPRDDLPVTEVLNQVCPSMWRGACKTAVQLLFGQAGL VVVDTAQIENKEAYAPQISLEGSRIVVQVPSTW - UNI13071 - WCLK

EDPATMSLLQRSLDPEKTLGLVDVLYTAVLDLNRWRTGR - UNI16580 - REQALPCIQIQLQRDICDFGNQADLPSGNGSKSSGLQKTFSKLTSRF

TKKVSCTNSGSTHYSKNIFTAGCSEERAKMMGNNIDTRLQSILNIGNFPRTTDPSQSSQNSSNPMVNGFLLERRENFLHGDDGKDEKGMNLPTDQEMQEV

IDFLSGFNMGQSHQGSPLVTRRNSTATAMVTEQKTGTMQPQQPSLPLAPPLRPPQAGAHTPLAAQQGLAPQQQSPKQQQPQVQYYQHLLQPIGSQQTPPQ

PRAPAKWVHGSSQHPSQPMAAGLSPLGQWPGISDLSSDLYSLGLVSSYMDNMMSEVLGQKPQGPRNNTWPNRDQSDGVFGMLGEILPFDPAV - UNI27

625 - VGSDPEFARYVAGVSQAMQQKRQAQHGRRPGNPRGNWPPMEDAHRTWPLPEFFTEG GDSLHSGWSGAQGDSASSSDETSSANGDSLFSMFSGP

DLVAAVKQRR - UNI23929 - RKHSSGEQETSTLPSPPLLTTVEDVNQ DNKTKTWPPKAPWQHPSPMPSTLPSPAAPLYAVASPGSQWNDTVQMLQ

SPVWAAANDCNTTSFTYVQTPPQPPPPPAHKAAPKGFKAFPGKAERRPAYLPQY

For any suggestions or comments, please send an email to unitrap@crg.es