Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000066842 (Hmcn1)
Chromosomal location
Chr 1: 152409654 - 152840565 (-)
Description
hemicentin 1 Gene [Source:MGI (curated);Acc:Hmcn1-001]
RefSeq_peptide
NP_001019891.2 
UniGene
Mm.476437 Mm.379425 Mm.410524 
MGI
MGI:2685047 
Uniprot/SPTREMBL
Q8C716 
Human Ortholog
ENSG00000143341 (HMCN1)
Omim 603075 - MACULAR DEGENERATION, AGE-RELATED, 1  
UniTrap UNI31645
Vector Insertion
Chr 1: 152666488 - 152706392
Public Clones IST14026C9 (tigm) IST10922D6 (tigm) IST14430C2 (tigm) IST10879B2 (tigm)
IST14995C8 (tigm) IST13081D5 (tigm) IST14976F8 (tigm) IST13059B10 (tigm)
IST13055B2 (tigm) IST12050C3 (tigm) IST13076H3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000097545
Sequence
AGTCGCTGGCCTGGAGCGCGGCGGCGGAGGCGGCACCGCAGGCTCGCAGCGTCCCCCAGGGCATGGACCCCGCGCTCTGCGGGCGCTCGGCTACTCGCAG

CTCCCTGCACGCGGCCGCTTAGAGCCCAGGACCTACCCAGCCGGACAAAAGGCGCCGCATCCCTGCCCAGCCCAGCCCAGCTCCTGGAGGCAGCCGGGCT

CCGGGTTGGTCTGCATCTCATTCTCCGCTCCAAAACTTTTGAGTTAGTTCAGAGACTGCAAAAGCCTGATGAGGCACCAGAGAGGAAGCCAGTCCTCTGC

CTGCTGTTGAGGAGTAAGCACAGTGGTTAGGAGCTTAGGGCAAAGAGAAAAGCAGCGAGCAAAACAAGAAAAGAAAAGAAAAAAATGATTGCCCAGGAAG

TGGTCCACACAGTATTCCTGGTGGCTCTTTTTCGTTCTTCCCTAGCTGGAGATGGGACTCCGCAGTCTGAGAGCAGGGCTGAGGAGATTCCTGAGGGGGC

GTCCACGCTGGCTTTTGTGTTTGATGTGACTGGGTCCATGTATGATGATTTAGTTCAGGTTATTGAAGGGGCTTCCAAAATTTTGGAGACGTCTTTGAAA

AGACCTAAGAGACCTCTTTACAACTTTGCTTTGGTGCCCTTCCATGATCCAG AAATTGGTCCAGTGACAATTACCACAGATCCAAAAAAATTTCAGTAT

GAATTGAGAGAACTGTATGTTCAGGTGAGTGAGGTGGGAAATCGCTTATCTTTGGCTGGCTCTCTTCATTTTTATAATCTGAAAGAAGTATTTGTTGTCT

CTCAAGGGACTCAAGAAATGTCATTTTCTTTCCCCACCCATGTCTAGAATGAATTACGCAATAGATACAGAATATGATATAGTAAGTTCATTTGCCCTGA

GACAATAGAGCTCAGAAGTTCTCGAAGAGGCTCTTTGGCTTCTTTATAGGAAGCATTTGCTGAGTCTAGTCCTACACAGGTCCCTTCCCTTTCTTACCAC

ATGAAAGACATAACCAAGGCAATTCTCCCTCCTATAGAGTTTTTGAGTGTGAATATCATATGGTTAATAGGAAAGGCCGGAAGCATTCCTTTAAGTATCA

TTTGAAAGCAGTGCTTGGAGAATGGGTGGGTGTCTATTGTCCCCTTAGTGCTACTAAATCCACTAAAAACAATTTCCTCAGTTCTGAAATCATCCTCTGC

AGCAAGCAGAGTACCCAAAGAAGTAATAGATAAAGTGTGTCGATTCGTGCGGCAGCCATTCTCCTTTCTCTTACCCCCACGGCACTTCCATGGTGGCCTG

GCTCTATTAGGAGCTGCAAGATGTGAGGTCACATCTGTATGGAGTCTCAGTCTAAGACAACAATTTTTTTTCCTGGTCCCATGGACAACGGAGCAAAAAG

CCTGCCCAGCCAGATAACTGTGTTGCAAGTCTGCTGACCTCCCAGGATGCTGGCTTCCCAGGCTAAGTCACTGGGAAGCTACTCAGTGAAGCCAACTTCC

TCTACACAGAGGAATTCAGGTAAAGAGATGGCAACACTGGAAGTGGGCTAGATTGTTGCTATTCTGTGTGTGCAGACTTAGAAAACATCCTTGCTTCTGT

ATCTGGATCCTTAAGTCGTCTCTTCCCCAATCCAACTAGAGAACAGAGTTCTCAGAGGCCAGGGCATTTCTTCCTTGGGTCTCCCTGGCTCCCCACTCAC

TGGCCTTCTGAAGAAGATTCCCTTTGCCCGCTTGACTGTTCTGGGCCTTGTAAAGGAGAATTAAATAGAGAAAATAAAAAAGGGTCATACAGATAGGGTC

ATGGCTGAGCTAAAGTGTCTTAGGAGTTTGATGTATGATGTGATGCGAAAGCAGCTTCAGGATGAAAGCAATTGTTGGTACTTTCATCCTCCTGCCTCAA

AGTGTTTCTGGGGTATAACAGGAGAAGTTGAGGTGTTCCGAGCCCTGACTGTGAGTCCCACCGACTCACCCTCAGACCCAGTTTGTTTCTTTTCTTCACT

CAGGCCTGTACTAGAAGGTACATTATCTTTGGGATCTGAAACCAAAAGTGTAAAAAGTTAGTTGTCAAATATAATCAACAGCCTGTGAGATGTTCTGAGT

TTGTGCTTTTCAAACTTTGTGCCAGGAGCCATGATAAAACATGTGCATGTTATATATCAAAAAAACAAACAGACAAAAAAAAACAATTTGCTTTTGTGAG

ACAGTTTTACTACACTCTCAGTGGCTTCTGCGGCTCTCATCTTACTGGGCTCTTTGTCACTTTCCATGGTTCTTGTAGACTCACAATATCTTGTTCATAG

TTACCTTTCCCCTCAGGGCTATGGTCATGCCCGGCAGGCCACTGCAGTGTGTGCTACCATCCTATTTAGATAGTACCTCCCCACTCCTTGATCTACTGGT

CTATCTCAGTGGACTTCCTCTGTTACATTTTAGTCTGGAATTCTCGCAAACACCCTGGATCTTACCACTCTTTCAAGTCTTCCTTTCCTCAGATAATTGA

TTCAGGCATCTCCGTCTCCATCAGCACACTGTCAGCAGAGATAGGCCGCAGCTTCTTAGCTTCCCCTTTGTCCTCAGGTCCAACAGGAGGTTCCGTCACG

AGGCTGGCATGCTTTCTCCCAGGCCATTAGACCTTCTGATCGCTCTCGTTCCACCATTCTAGTGCAGAGACTTATCATTTTAAAACACTGTTCTGTCTTC

CCTGTGCAGCAGCGTTCAGTTCCAAAGGCAGAACCTCATGACTATCTGCATGGTTCATGCTTATCCATCAGTTTGCCAAGTGTTGGGAAAGTCTCACAAC

ACGGCCCAATATACCACCGGCTCTAGAGGATGGAGTGATAGATAGCTACTCCAGAATGTGCACATGAGCACAGGTCAAAGTGAAGTTTGAAGGATAGTAT

TTAATTAGTTGCAGTGTTAGCCGAGCAGCTTGAGTGGGAACTCTGGGGCTGCTTCTGTTTGTGCATGTCTTGGTGTGCACACGGAACTGAGTTATAGTTA

ATGAATATGCAGATGAATTTGCATAAGCATCCCTTGATTTTAATTATGTTTCCTATCAGTAATCCTCCATCCCTTTGCCCTTATAGCGTGTTGCTACAAT

GGCCATTAAATTGCTACTTAATATGCAGTCACTTTTTTCTCCCTTACAATTGAAAAATCTTTAGATGTTGAGATTCTCTGAGGAAAAAAAAAGTTGTTAG

AGAATTGTTTATCCCATTAAGGGATTATCCCTGGTGGCATTCCATGTTCTTGGTTGCCTCCGTCTCTACATTCACCTATTTTACTGTGAACCTCTGAGCA

CAAGAGCCCCATAGTTCTCACGTAGCCTGTGCTTCATCTAGAGGAAGAACCACGGTTATAGGGAGGGGTTTCGATAGTTGTTGGATAAATGAATAACACT

T
Translation
MIAQEVVHTVFLVALFRSSLAGDGTPQSESRAEEIPEGASTLAFVFDVTGSMYDDLVQVIEGASKILETSLKRPKRPLYNFALVPFHDPE EIGPVTITT

DPKKFQYELRELYVQVSEVGNRLSLAGSLHFYNLKEVFVVSQGTQEMSFSFPTHV
Transcript ENSMUST00000077512
Sequence
CACTGCCCAGCCATATGGAGAGCTCATCTTGGAAAATGTTGTG CTGGAAGATTCTGGCACCTACACATGTGTCGCTAACAATGCTGCTGGTGAAGATAC

ACGTATTGTGACCCTGGCTGTGCATACCCTTCCCACTTTTACTGAACTTCCTGGAGACCTGTCATTAAATAAAGGAGAACAGCTACGGTTAAGTTGTAAA

GCCGTTGGCATCCCATTGCCCAAACTAACGTGGACCTTCAACAACAATATTATTCCAG CCCACTTTGACAGCATCAATGGACACAGTGAACTCGTTATT

GAAAAGGTGTCAAAGGAGGACTCGGGCACTTACGTGTGCACCGCGGAGAACAGTGTTGGCTTTGTGAAAGCGATCGGATTTGTTTATGTGAAAG AGCCC

CCAGTCTTCAAAGGTGATTACCCATCTAACTGGATTGAACCACTCGGAGGGAACGCAATCCTAAACTGTGAGGTAAAAGGAGACCCTGCCCCAACCATCC

AATGGAGCCGCAAGGGGGCTGACATAGAGATTAGCCACAGGATCCGACAACTGGGTAATGGTTCCTTGGCCATCTACGGCACTGTG AATGAAGATGCTG

GTGACTATACCTGTGTAGCTGCCAATGAGGCCGGGATGGTGGAGCGCAGCATGAGCCTGACTCTGCAAA GTTCTCCTATTATCACTCTTGAGCCAGTGG

AAACTGTTGTAGATGCTGGTGGCAGAGTCATACTGGATTGCCAAGCAGCTGGTGAACCGCAGCCAACCATCACATGGTCCCGCCAAGGGCAACCCATCTC

CTGGGATAACCGACTTTCCATGCTGCCTAACAGCTCATTATACATCGCTGCTGCTCGTAAGGAAGATACTTCTGAATATGAATGCGTTGCCCGAAACTTG

ATGGGCTCTGTCCTGGTCAGAGTGCCTGTCATAGTCCAGG TGCACGGTGGGTTTTCATTGTGGTCTGCCTGGAGGCCCTGCAGTGTCACCTGTGGAAAA

GGCATCCAAAAGAGGAGCCGGCTGTGCGACAACCCACCTCCAGCCAATGGAGGGAGGCCATGCCAAGGGGCGGATTCAGAAGCGCGACACTGTCACAATA

AGCTGTGTCCAG TGGATGGTCACTGGTCAGAATGGAGTTTCTGGGAAGACTGCTCAAGAAGCTGTGGGCATGGCAACCAAACTAGGACGAGAACTTGCA

GCAACCCGCCGGCTCAGCATGGCGGGCGGCCATGCGAGGGGCATGCTGTGGAAACCATTATGTGTAACATCAGGCCTTGCCCAG TCCATGGTGTGTGGA

ATGCTTGGCAGCCTTGGAGTGCGTGCAGCAAAAGCTGTGGAAAAGGCAGTCAGACCAGAATGAGACTTTGCAACAACCCGCCACCGTCATTTGGTGGGGC

CCACTGCAGTGGAGCAGAAACCCAGATGCAAGTCTGCAATGAGAGACACTGTCCAG TGGATGGCAGGTGGGCGACTTGGAGCAGTTGGAGTGCCTGCAC

CGTATCCTGCGGAGGAGGTGCCAGGAAGAGAACAAGGGACTGTTCTGACCCAGTGCCACAGTATGGAGGAAACAAATGTGAAGGGACTGGTGTCCAGAGT

GACTTTTGCAATAGTGACCCTTGTCCAA CCCATGGTAACTGGAGCCCTTGGAGCGGCTGGGGGACGTGCAGTCGGACATGCAATGGAGGGCAGATGAGG

CGGTACCGCACATGTGATAATCCACGTCCCTCCAATGGAGGAAGAGCCTGTGGGGGTCCAGATACCCAGATCCAGAGGTGCAACACTGACATGTGTCCTG

 TGGACGGAAGTTGGGGAACATGGCACAGCTGGAGCCACTGTTCTGTCTCTTGTGGAGGAGGTGAAAGGACTCGAAAGCGACTATGTGACAATCCAGTGC

CAACTAAAGGTGGCCGTTCCTGTCCGGGAGATGCCACCCAGGTCTCCAGATGTAACATGCAAGCATGTCCAG GTGGACCCCAGCGAGCCAGAGGAAGTG

TTATTGGAAATATTAATGATATTGAGTTTGGAATCGCTTTCCTAAATGCCACAATAACAGATAGCCCTAACACTGATACAAGAGTAATACAGGCCAAGAT

TACCAATGTGCCTCGCAGTCTTG GTCCAGCAATGAGAAAGATCATTTCTATCCTAAATCCCATTTACTGGACCACAGCAAAGGAAATAGGGGAAGCAGT

TAATGGCTTTACCCTCACTAACGCAGTCTTCAAAAGAGAGACGCAAGTGGAATTTGCAACTG GAGAGGTCTTGCGGATGACACACGTGGCTCGGGGCTT

AGACTCCGACGGCGCCTTGCTGCTTGATGTCATTGTGAGTGGCCAGGTCCTACAGCTCCACTCACCTGCTGAAGTCGGTGTGAAG GATTACACAGAGGA

CTACATTCAAACAGGACCCGGTCAGCTCTATGCCTACTCAACTCGTCTGTTCACCATCGATGGCATCAGTATCCCCTATACGTGGAACCACACCATTTTC

TATGATCAGGCCTGGGGGAAAATGCCTTTCTTAGTAGAGACACTTCATGCATCTTCCATAGAGTCTGACTACAACCAACTAGAAGAGACACTGGGTTTTA

AAATCCATGCTTCAATTTCCAAAG GAGATCGCAGTAACCAGTGCCCCTCTGGGTTCATTTTAGACTCGGTTGGACCCTTTTGTGCAG ATGAAGATGAA

TGCACAGCTGGGAACCCCTGCTCTCATACCTGCCACAATGCCATAGGAGCCTATTACTGCTCCTGCCCCAAAGGCCTCACCATAGCTGCAGATGGGAGAA

CCTGTCAAG ACATTGATGAGTGTGCTTTGGGTGGACATACCTGTCGTGCTGGTCAGGACTGTGACAACACCATTGGATCCTATCGCTGTGTGGTCCATT

GTGGAACAGGCTTCCGAAGAACCTCTGATGGGTTAAGCTGTCAAG ATATTAATGAATGTCAGGAGTCCAGCCCCTGTCACCAGCGATGTTTCAACGTCA

TAGGAAGTTTCCATTGTGGATGTGAAGCTGGCTATCAACTCAAAGGCAGAAAATGCATCG ATGTGAATGAATGTAGACAGAATGTGTGCAGACCAGACC

AGCATTGTAAGAACACCCGCGGTGGCTACAAGTGCATTGATCTTTGTCCAAGTGGAATGACCAAGGCTGAAAATGGGACCTGCATTG ACATAGATGAGT

GCAAAGATGGGACCCATCAGTGCAGATATAACCAAATATGTGAGAACACGAGAGGCAGCTACCGGTGTGCATGCCCAAGGGGTTATCGGTCCCAAGGTGT

TGGAAGACCCTGTATTG ATATTGATGAATGTCAAAACAGAGACACTTGCCAACACGAGTGTAAAAACACGATCGGGAGCTACCAGTGCGTCTGCCCACC

AGGTTATCGACTCATGCTCAATGGGAAAACGTGCCAAG ATGTAGATGAGTGCCTGGAGCAGAATGTCCGCTGTGGACCAAATCGAATGTGTTTCAACAT

GAGAGGAAGCTACCAGTGCATCGACACACCCTGCCCACCCAACTACCAACGGGATCCTGTTTTGGG GTTCTGCCTTAAGAACTGTCCACCCAATGACTT

GGAATGTACCTTAAGCCCATATGCCTTGGAATATAAACTTGTCTCCCTCCCATTTGGAATAGCCGCCAATCAAGATTTAATCCGGCTGGTTGCATACACA

CAGGATGGCGTGATGCATCCCAGGACAACTTTCCTCATGATAGATGAGGAACCAGCTGTCCCTTTTGCCTTAAGGGATGAAAACCTGAAAGGAGTTGTGT

ACACTACACGTCCACTACGAGAGGCAGAGACCTACCGCATGAAGGTGGGAGCTTTATCCTACAGTGCCAATGGGACCATTGAGTATCAGACTACATTCAT

AGTTTATATAGCTGTGTCTGCCTATCCGTACTAG
Translation
 EQLRLSCKAVGIPLPKLTWTFNNNIIPA AHFDSINGHSELVIEKVSKEDSGTYVCTAENSVGFVKAIGFVYVKE EPPVFKGDYPSNWIEPLGGNAIL

NCEVKGDPAPTIQWSRKGADIEISHRIRQLGNGSLAIYGTV NEDAGDYTCVAANEAGMVERSMSLTLQS SSPIITLEPVETVVDAGGRVILDCQAAGE

PQPTITWSRQGQPISWDNRLSMLPNSSLYIAAARKEDTSEYECVARNLMGSVLVRVPVIVQV VHGGFSLWSAWRPCSVTCGKGIQKRSRLCDNPPPANG

GRPCQGADSEARHCHNKLCPV VDGHWSEWSFWEDCSRSCGHGNQTRTRTCSNPPAQHGGRPCEGHAVETIMCNIRPCPV VHGVWNAWQPWSACSKSCG

KGSQTRMRLCNNPPPSFGGAHCSGAETQMQVCNERHCPV VDGRWATWSSWSACTVSCGGGARKRTRDCSDPVPQYGGNKCEGTGVQSDFCNSDPCPT T

HGNWSPWSGWGTCSRTCNGGQMRRYRTCDNPRPSNGGRACGGPDTQIQRCNTDMCPV VDGSWGTWHSWSHCSVSCGGGERTRKRLCDNPVPTKGGRSCP

GDATQVSRCNMQACPG GGPQRARGSVIGNINDIEFGIAFLNATITDSPNTDTRVIQAKITNVPRSLG GPAMRKIISILNPIYWTTAKEIGEAVNGFTL

TNAVFKRETQVEFATG GEVLRMTHVARGLDSDGALLLDVIVSGQVLQLHSPAEVGVK DYTEDYIQTGPGQLYAYSTRLFTIDGISIPYTWNHTIFYDQ

AWGKMPFLVETLHASSIESDYNQLEETLGFKIHASISKG GDRSNQCPSGFILDSVGPFCAD DEDECTAGNPCSHTCHNAIGAYYCSCPKGLTIAADGR

TCQD DIDECALGGHTCRAGQDCDNTIGSYRCVVHCGTGFRRTSDGLSCQD DINECQESSPCHQRCFNVIGSFHCGCEAGYQLKGRKCID DVNECRQN

VCRPDQHCKNTRGGYKCIDLCPSGMTKAENGTCID DIDECKDGTHQCRYNQICENTRGSYRCACPRGYRSQGVGRPCID DIDECQNRDTCQHECKNTI

GSYQCVCPPGYRLMLNGKTCQD DVDECLEQNVRCGPNRMCFNMRGSYQCIDTPCPPNYQRDPVLG GFCLKNCPPNDLECTLSPYALEYKLVSLPFGIA

ANQDLIRLVAYTQDGVMHPRTTFLMIDEEPAVPFALRDENLKGVVYTTRPLREAETYRMKVGALSYSANGTIEYQTTFIVYIAVSAYPY
Transcript ENSMUST00000074783
Sequence
AGTCGCTGGCCTGGAGCGCGGCGGCGGAGGCGGCACCGCAGGCTCGCAGCGTCCCCCAGGGCATGGACCCCGCGCTCTGCGGGCGCTCGGCTACTCGCAG

CTCCCTGCACGCGGCCGCTTAGAGCCCAGGACCTACCCAGCCGGACAAAAGGCGCCGCATCCCTGCCCAGCCCAGCCCAGCTCCTGGAGGCAGCCGGGCT

CCGGGTTGGTCTGCATCTCATTCTCCGCTCCAAAACTTTTGAGTTAGTTCAGAGACTGCAAAAGCCTGATGAGGCACCAGAGAGGAAGCCAGTCCTCTGC

CTGCTGTTGAGGAGTAAGCACAGTGGTTAGGAGCTTAGGGCAAAGAGAAAAGCAGCGAGCAAAACAAGAAAAGAAAAGAAAAAAATGATTGCCCAGGAAG

TGGTCCACACAGTATTCCTGGTGGCTCTTTTTCGTTCTTCCCTAGCTGGAGATGGGACTCCGCAGTCTGAGAGCAGGGCTGAGGAGATTCCTGAGGGGGC

GTCCACGCTGGCTTTTGTGTTTGATGTGACTGGGTCCATGTATGATGATTTAGTTCAGGTTATTGAAGGGGCTTCCAAAATTTTGGAGACGTCTTTGAAA

AGACCTAAGAGACCTCTTTACAACTTTGCTTTGGTGCCCTTCCATGATCCAG AAATTGGTCCAGTGACAATTACCACAGATCCAAAAAAATTTCAGTAT

GAATTGAGAGAACTGTATGTTCAG GGAGGTGGTGACTGTCCAGAAATGAGCATCGGGGCTATAAAGATTGCCTTGGAAATCTCTCTTCCTGGGTCCTTC

ATCTATGTTTTCACTGATGCACGATCCAAGGATTATCGGCTCACCCATGAGGTGCTGCAGCTTATCCAACAGAAACAATCTCAG - UNI31645 - GT

GGTATTTGTGCTCACTGGAGACTGTGATGACAGGAATCATATTGGATATAAAGTCTATGAAGAAATTGCCTCTACAAGTTCTGGTCAAGTGTTCCATCTG

GACAAAAAGCAAGTGAATGAG - UNI31645 - GTGTTGAAGTGGGTGGAAGAAGCTGTGCAGGCCTCCAAGGTTCACCTCTTATCCACCGATCATTT

GGAGCACGCTGTGAATACTTGGAAAATTCCTTTTGATCCCAGCCTCAAAGAAGTTACTGTGTCCCTGAGTGGCCCGTCTCCCGTGATTGAGATTCGCAAT

CCTTTCG - UNI31645 - GGAAGCTGATAAAAAAGGGATTTGGCCTGAATGAGCTGTTAAATATCCATAACTCTGCCAAAGTGGTGAATGTCAAAGA

GCCTGAAGCTGGCATGTGGACAGTGAAG ACCTCCAGCAGTGGAAGGCATTCTGTTCGTATCACCGGTCTCAGCACTATTGATTTCCGAGCTGGCTTTTC

TCGAAAGCCCACGCTGGACTTCAAAAAAACAATGAGCAGACCCGTGCAAG GAATACCTACGTATGTGCTACTGAACACTTCTGGAATCTCCAGTCCAGC

TAGAGTAGACCGTCTCGAACTTCTGAGTATCTCAGGGGGATCTCTTAAGACCATTCCTGTTAAGCATTACCCAGATCGGAAGCCTTACGGCATCTGGAAT

ATTTCTGACTTCATTCCCCCAGATGAAGCTTTCTTTCTCAAGGTGACAGGCTATGACAAAGATGGTTATCTCTTCCAGAGAGTGTCAAGTGTTTCTTTTT

CCAGCATTGTCCCAG ATGCTCCCAAAGTTACAATGCCCACAAGAACGCTGGGATACTACCTGCAGCCAGGCCAAATCCTCTGTTCGGTTGAGAGTTTTT

TGCCCTTTACTTTGAGTTTCATGAGAGATGGAATTGCCCTGGGAGTAGACCAATATTTAAG AGAATCTGCCAGCGTGAACTGGGACTTCACAAAGGTGA

CGTTGTCTGACGAGGGCTTCTATGACTGTATCGCTGTGAGCAGCGCAGGGACGGGACGGGCACAGACGTTCTTTGATGTATCAG AGCCTCCTCCGATCA

TCCAACTGCCTAATAATGTAACAGTCACTCCTGGAGAAAGAGCAGTTTTGGCATGTCTTGTCATCAGTGCCGTGGATTATAACCTAACCTGGCAGAGGAG

TGGCAGAGATATCCGACTAGCAGACTCAGCAAGAATTAGGACCTTGGCCAACCTCTCACTGGAGCTGAGGAGTGTGAAAATTGGTGATGCTGGGGAGTAC

CGTTGTGTGGTTTCCAGTGAAGGGGGATCAGCAGCAGCTTCAGTTTTCCTCACAGTCCAAG AAAAACCCAAAGTCACTGTGATGCCCAAGAATCAGTCT

TTCACAGGAGGGTCTGAGATCTCCATCATGTGTTCTGCAACAGGATATCCCAAACCGAAGATTGTCTGGACCATGAATGAGATGTTTATCATGGGTTCAC

ACAG GTACAGGATGACCTCAGAAGGTACCTTATTCATCAAGAATGCAGTTCCTAAAGATGCAGGGACCTACGCTTGCCTGGCAAGCAATGCAGCTGGAA

CAGATAAGCAAACATCCACTCTCAGATACATAG AAGCCCCAAAGTTGGTGGTAGAGCAGAGTGAGCTCTTGGTGGCCCTTGGGGATACAACAGTTATGG

AATGTAAAACTTCTGGGATTCCTCCACCTCAAGTAAAGTGGTTCAAAG GAGATCTCGAGTTGAGGCCCTCAACATTCCTCAGTATTGACCCTCTCGTGG

GACTTTTGAAGATTCAAGAAACACAAGATCTGGATGCTGGTGACTATACCTGTGTAGCCATCAATGAAGCAGGAAGAGCAACAGGCAGACTAACTCTGGA

TGTAGGCT CACCTCCGGTTTTCATACAAGAACCTTCTGATGTGGCCGTGGAAATTGGCTCCAATGTGACATTGCCTTGTTATGTTCAGGGTTATCCAGA

ACCAAAGATCAAATGGCGTAGGCTGGACAACATGCCAGTTTTCTCAAGACCCTTTTCAGTTAGTTTCATCAGCCAGCTGAGAACAGGAGCTCTCTTTATT

TCAA ATTTATGGGCAAGTGATAAAGGAACGTACATCTGTGAAGCTGAGAACCAGTTTGGAAAAATACAGTCGCAGACAACAGTAACGGTGACAGGACTC

G TTGCCCCACTTATTGGAATCAGCCCTTCCATGGCCAGCGTTATTGAAGGACAGCCTCTAACTCTGCCTTGTACTCTGTTGGCTGGAAATCCCATTCCA

GAACGGCGGTGGATGAAGAACTCAGCCATG TTGGTACAAAATCCCTACATAACTGTGCGCAGCGATGGGAGCCTCCATATTGAAAGAGTTCGACTTCAG

GATGGAGGCAAATACACTTGTGTGGCCAGTAATGTCGCTGGAACCAATAACAAAACAACCTCTGTGGCCGTGCATG TTCTGCCAAGCATTCAGCACGGC

CAGCAGATACTGAGCACAATTGAAGGCGTTCCAGTAACTCTACCCTGCAGAGCGAGTGGGATTCCCAAGCCATCTATCACCTGGTCAAAG AAAGGAGAG

CTGATTTCAACGAGCAGTGCCAAGTTTTCTGCAGGGGCTGATGGGAGTCTGTATGTGGTGTCACCAGGGAGTGAGGAGAGTGGCGAGTACATCTGTACAG

CCACCAATGCAGCCGGCTATGCCAAGAGGAAAGTGCAGCTGACTGTCTATG TAAGACCCAGAGTGTTTGGGGACCAAAGAGGACTGTCCCAAGATAAGC

CTGTGGAGATCTCTGTCCTGGCTGGGGAGGAGGCAATACTTCCCTGTGAAGCTAAGAGCTTACCTCCACCCATCATTACCTGGGCCAAAGATAGCCAACT

CATCTCTCCATTTTCTCCAAG ACACACGTTCCTCCCTTCTGGCTCAATGAAGATCACAGAGACCCGCGTTTCAGACAGTGGGATGTATCTGTGTGTTGC

CACAAATATTGCTGGGAATGTGACTCAGTCCGTTAAATTAAGTGTCCACG TTCCTCCAAAAATACAGCATGGAAATCGACACATAAAAGTCCAAGTCGG

CCAGAGAGTGGACATCCTATGCAATGCCCACGGGTCTCCGCCTCCCGTGATCACCTGGTTTAAAAGCGGAAGGCCGTTCCTTGATGGAGCGCAGCATCCT

GGTAGCCCAGACGGAACGCTGAGCATTGAGCAGGCTGTGATCTCAGATGCTGGCGTATATACATGTGCTGCCACGAACATAGCCGGAAGTGATGAAGCAG

AGGTCACATTGCATGTCCAAG AACCACCTTCAGTGGAAGACCTGCAACCTCCTTTTAACACTCCGTTCCAAGAAAGGTTGGCCAATCAGCGCATCGAAT

TTCCATGCCCTGCAAAAG GTACTCCTAAACCAACCATCAAGTGGTTACACAATGGCAGAGAGGTGACAGGGCAAGAGCCTGGTGTTTCTATCTTGGAAG

ATGGCGCACTGTTGGTAATCGCTTCTGTTACACCACACAACAATGGCGAGTACATCTGTGTGGCCGTCAATGAAGCTGGGACCACAGAAAGGAAATACAA

CCTCAAAGTTCATG TTCCACCAGTAATTAGAGATAAGGAACATGTGACCAATGTGTCCGTGTTGACAAGCCAACTGGCCAGCCTCTACTGTGAAGTAGA

AGGAACTCCGTCCCCTGTCATAACATGGTATAAGGACGACATCCAG GTGACAGAAAGCAGCACTGTTCAGATTGTGAACAATGGAAAGATTCTAAAACT

CTTTAAGGTGTCTGCCGAGGATGCGGGAAGATATTCCTGCAAAGCAATTAATATTGCAGGCACCTCTCAGAAGGACTTTAGTGTCAATGTACTAG TTCC

ACCCAGCATACTAGGTGCCAGCTCCCCGAGTGAAGTCTCAGTTGTTCTTAACCACAACGTCACCCTGCAGTGTCCTGGCACAGGCGTCCCCTTTCCGGCT

ATTCACTGGTTCAAGGATGGCAA GCCTTTATTTTTGGGAGATCCTAACATTGAACTCTCAGACAGAGGACAGAGTTTACATCTGAGAAATGCACGGAGA

AGTGACAAGGGACGCTACCAATGTACTGTGTCCAATGCAGCAGGCAAGCAAGCCAAGGATATAAAACTCACTGTCTATG TTCCACCTAGTATTAAAGGA

GGCAATATTACCACAGAAATATCAGCGTTGCTCAACAGTATAGTTAAACTGGAATGTGAGACACGGGGGCTCCCAGTGCCTGCCATTACTTGGTATAAGG

ATGGCCAGGTAGTCACATCCAGCTCACAAGCACTTTATATTGACAAAGGACAACTTCTCCACATTCAGAGAGCACAGGTCTCTGACTCAGCAACATACAC

ATGTCATGCAGCCAACGTTGCTGGAACGGCTGAGAAATCATTCCATGTTGACATCTATG TTCCTCCAACAATCGAAGGTGACTTGACCGCTCCTTCAAA

TAAGCAAGTCATTATTGGTCAGTCGTTGATCTTGGAGTGTAAAGCTGCTGGCAACCCTCCTCCCATTCTCACTTGGTTAAAAGATGGCGTGCCTGTGAAA

GCCAGTGACAACATCCACATCGAAGCCGGTGGGAAGAAGCTCGAAATCTTGAGTGCCCTAGAAGTTGATCGGGGACAGTACATATGTGTAGCTACCAGTG

TGGCAGGAGAACGGGAAATCAAGTATGAAGTTGATGTCTTGG TGCCACCGGCTGTGGAAGGAGGAGAGGAAACATCTTACTTCATTGTGTTGGCAAATA

ACTTACTGGAGCTAGACTGTCAGGTCTCAGGCTCTCCCCCACCAACTATCAT GTGGCTAAAAGGTGGTCAGTTAATTGATGAGAGAGATGGATTCAAGA

TCTTACTAAATGGACGCAAACTCGTTATTGCTCAGGCTCAAGTGTCAGACACAGGCCTTTACCAGTGTGTGGCAACAAACATTGCAGGGGACCACAGGAA

GGAGTTTGAAGTGACCGTTCATG TTCCTCCAACAATCAAGTCCTCAGACCTTCCTGAGAAGACTGTGGTGAGATACAAGCCAGTTACCTTGCAGTGCAT

AGCCAATGGCATTCCAAATCCATCCATTACATGGCTGAAGGATGACCAGCCTGTGAACACTGCCCATGGGAACCTCAAA ATACAGTCTTCTGGTAGAGT

TCTACAAATTGCCAAGGCTCTTTTGGAAGATGCTGGTAGATACACATGTGTGGCTACCAATGCAGCTGGAGAAGCACACCAGCACACTCAACTGCATGTG

CATG AACCCCCAAGCCTGGATGACGCGGGAAAGATGCGGAATGAGACAGTGGTGGTGAATAACCCCATACAGCTGGAATGTAAAGCCACAGGCAAGCCT

CTTCCTG TTATCACGTGGTACAAAGACAGCCATCCCCTCTCAGGCTCTGCAAGTGCAGCCTTCCTGAAGAGAGGCCAGGTCCTTGAGATTGGGAGTGCT

CAGATCTCAGATGCTGGCATCTACAAATGTGTAGCCATCAACTCTGCTGGAGCTACAGAACTGTTTTACAGCCTACAAGTTCATG TGCCTCCTTCGATC

TCAGGTAGCAGTTCCATGGTGGAGGTGGTGGTGAATAATCTAGCAAGGTTAGAATGTGAAGCCAGAGGCATCCCTGCCCCGAGTCTGACCTGGCTGAAAG

ATGGGAGCCCAGTCTCTAGCTTCTCTAATGGAATACAG ATTCTCTCGGGAGGTCGCATCTTGGCACTGACCAGTGCTCAGATGAGTGACGCAGGAAGGT

ACACCTGCGTGGCAGTGAACGCTGCTGGGGAGAAACAAAGGGACATTGACCTCAGAGTCTATG CTCCACCCAATATTATGGGAGAAGAACAGAATGTCT

CCGTCCTCATTGGCCAAGCTGTGGAGTTGTTTTGTCAAAGTGATGCTGTTCCTCCCCCTACTCTGATGTGGTTGAAGGATGGCCGCCCTCTGCTGAAGAG

ACCAGGTCTCAGTATCTCTGAAAACGGAAGTGTGCTTAAG ATTGAAGATGCTCAGGCCGGAGACACTGGTCGTTACACCTGTGAAGCCACCAATGTTGC

TGGGAAAACGGAGAAGAACTACAACGTTAACGTCTGGGGTGAGTATAATGA TATTTATGGCTCTGATGAGCTTGTGCAACTTACAGCCATTGAAGGGAA

TCTTATCACTCTCCTATGTGAATCAAGTGGAATCCCACCCCCAGATCTTACCTGGAAGAAGAAAG GTTCTCTGGTGTTGGCTGACTCTGCAGGACGTGT

TCACATTTTATCTGGTGGCAGACGACTACAAATTTCGATTGCTGAGAAAGCAGATGCAGGACTCTACACATGTGTGGCGTCCAATGTGGCTGGAGTTGCA

AAGAAAGAGTATAACCTGCAAGTGTATA TCCGACCATCAATAACCAACAGTGGTGGCCACCGCCCTGAGATTACTGTCATCCGTGGGAAAAGTATTTCT

TTGGAATGTGAGGTGCAGGGTATTCCTCAGCCAACAGTGACCTGGATGAAAGATGGCCGCCCCTTGACCAAGGGAAAAGGAGTGGAAATATTGGATGAAG

GCCGAATCCTTCAGCTGAAGAATGTTCATGTGTCTGACACCGGCCGTTATGTGTGTGTTGCTGTGAATGTAGCAGGAATGACTGACAAGAGATACGACTT

AAGTGTTCATG CCCCTCCAAGCATCATCGGGAACCACGGAGTCCCTGAGAACGTCAGTGTGGTGGAAAAGAGTTCTGTATCCCTGACCTGTGAAGCCTC

CGGCATCCCCCTGCCTTCCATAACCTGGCTAAAGGATGGCTGGCCTGTCAACCTTGGCAGTTCTGTGAAAATTCTCTCAG GAGGCAGGATGCTGCGGTT

GATGCAGACCAGACCAGAAGATGCTGGCCAATATACTTGTATTGTAAGGAATGCAGCTGGTGAAGACAGGAAAATGTTTGGACTTTCAGTATTAG TTCC

TCCTCACATTGTGGGTGAGAACACATTGGAAGATGTAAAGATTAAAGAGAAACAGAGTGTTACCTTGACTTGTGAAGTGAGAG GGAATCCTGTGCCACA

GATCACGTGGCACAAAGACGGACAGCTTCTCCAAGAAGATGAAGCCCACCACATGATGTCTGGTGGCCGTTTTCTTCAGATCACCAATGCTCAAGTGTCA

CACACAGGACGATATACATGTCTGGCCTCTAATATAGCTGGTGACAAAAGCAAAAGCTTCCGTCTCAACGTGTTTG TATCTCCTACAATTGCTGGTGTA

GACAGTGATGGCAGCCCTGAAGATGTCATTGTCATCCTTAACAGTCCCACTTCCTTAGTCTGTGAGGCATATTCCTACCCCCCTGCTACCATCACCTGGT

TCAAGGACGGCACACCTTTAGAATCCAACCGAAACATTCGCATTCTTCCAG GAGGCCGTACTCTGCAGATCCTAAACGCGCAGGAAGACAATGCTGGAC

GGTACTCATGCGTGGCCACTAACGAGGCCGGGGAGAAGATAAAGCACTATGAAGTGAAGGTCTACA TTCCACCCATAATCAAGAAAGGGGACCTCTTGG

GGCCAGGTCTTTCCCCTAAGGAAGTGAAGATCAGAGTGAATAGCAGCCTGACACTGGAGTGTGAAGCTTACGCCATTCCTTCTGCCTCCCTCCGCTGGTA

CAAGGACGGACAG CCCCTTAAATCGGATGATCATGTTACCATCGCCGCAAGTGGACATACTCTTCAAATAAAGGAAGCTCAAATCTCAGACACTGGACG

ATATACCTGTGTGGCATCTAACCTTGCAGGCGAAGATGAGTTGGATTTTGATGTGAATATACAAG TTCCTCCAAGTTTTCAGAAACTCTGGGAAATAGG

AAACATGTTAGATACCGGCAGGAGCGGTGAAGCTAAAGACGTGATCATCAACAACCCCCTTTCTCTGCACTGTGAGACAAATGCTGCTCCTCCACCAACT

CTGACATGGTACAAAGATGGCCGACCTCTGACCTCCAGTGACCGAGTATTGATTTTACCAG GAGGACGGGTGCTGCAGATTCCCCGGGCTAAGGTAGAA

GATGCCGGGAGATACACATGTGTGGCTGTGAATGAAGCTGGGGAAGACTCCCTTCGGTATGACGTCCATGTGCTCT TGCCACCAGTTATCAAGGGAGCA

AACAGTGATCTGCCAGAAGAGGTCACCGTGCTAGTGAACAAGAGTACACAGATGGAATGTTCATCCAGTGGTAACCCAGCACCGAGAAATTACTGGCAAA

AAGATGGACAGATCTTGTTAGAAGATGAACATCATAAGTTCCAGTCTGATGGCAGGAGTCTTCAG ATTCTAAATGCTCAAATAACAGATACTGGAAGGT

ATGTGTGTGTCGCAGAGAACACTGCTGGGAGTGCCAAGAAATACTTTAACCTCAACGTTCATG TTCCTCCAAGTGTCATTGGTCCTAACCATGAACATC

TCTCTGTGGTTGTGAACCATTTCATCTCTTTGAACTGTGAAGTTTCTGGTTTTCCCCCTCCTGACCTCAGCTGGCTCAAGAATGAAGAGCCAATCAAGCC

AAACACGAATGTTCTCACCGTGCCTG GTGGTAGAACTCTACAGATTATCCGGGCCAAGATATCAGATGGAGGCGACTATACCTGCATTGCTATCAACCA

AGCTGGAGAAAGCAAGAAAAAAGTTTCACTGACTGTTCATG TGCCCCCAAGCATCAAGGATCACGGCAGCCAATCTCTTTCTATAGTGAATGTAAGAGA

GGGGACCTCAGTGTCTTTGGAATGTGAGTCAAATGCTGTGCCTCCTCCAGTCATCACCTGGTCTAAGAATGGGCGGATGATACCAGATTCTACCAACGTG

GAGATTTTAACTGGTGGACAAACACTACACATCAGACGAGCCGAG GTGTCTGACACAGGCCAGTATGTATGTAGAGCTATAAATGTAGCAGGACGAGAT

GATAAAAATTTCCACCTCAATGTATATG TGCCTCCTACTATTGAAGGGCCGGAAACAGAAGTCATTGTGGAGACAATCAGCAATCCAGTGACATTGACT

TGTGATGCCACTGGGATCCCGCCTCCCACCATAACATGGTTAAAGAACCACAAGCCTATAG AAAATTCTGACCCCCTTGAAGTTCACATTTTGTCTGGA

GGAAGCAAACTGCAGATCGCCCGACCTCAGCGTTCAAACAGTGGAAACTACACGTGTGTTGCATCCAATATGGAGGGAAAGGCTCAGAAAAACTTTATCC

TTTTCATTCAGG TCCCTCCAAGTGTTGCCGGTGCTGAAGTTCCAAGTGAAGTTAGTGTCCTTCTCGGGGAAAATGTTGAGCTGGTCTGCAATGCAGATG

GCATTCCCACCCCTCATCTTCAGTGGCTTAGGGATGGAAAACCCATAGTGAATGGCGAAACAGAGCGAGTCAG GGTCACCACAGATGGCAGCACATTAA

ACATTTACAGAGCCCTCACATCTGACATGGGGAAGTATACATGTGTGGCTACGAATCCCGCTGGAGAAGAAGATCGAATATTTAACTTGAATGTCTATG 

TTCCACCTAAAATCCGAGGTAATAAAGAAGAGGCAGAGAAGCTGATGGCTCTGGTAGACACATCAATAAATATTGAATGCAAAGCCACTGGGACGCCCCC

ACCGCAGATCAACTGGCTGAAGAACGGCCTTCCTCTACCCATCTCTTCCCACATTCGCTTGCTGTCAGCGGGGCAGGTTGTCAG GATCGTGAGAGCTCA

GGTGTCTGATATCGCTGTATATACTTGTGTGGCCTCCAATAGAGCTGGGGTAGACAGTAAGCACTACAGCCTTCAAGTCTTTG TGCCACCGAATATGGA

CAACGCAATGGGAACAGAGGAAATCACGATTGTCAAAGGCAGTTCTACCTCTATGACGTGCTTTACAGATGGAACCCCAGCTCCTAGCATGTCTTGGCTC

AGAGATGGCCAGCCTCTGGCGCCTGATGCTCATCTGACTGTCAGCACTCAGGGAATGGTCCTTCAGCTCATCAAGGCAGAAACGGAAGATACTGGAAAGT

ACACCTGTGTTGCCACAAATGAAGCTGGAGAAGTCAGCAAGCATTTTGTCCTGAAAGTCCTAG AGCCACCTCACATTAACGGATCTGAAGGACCTGGAG

AGGTATCTGTAATTGTAAATAACCCACTTGAATTATCCTGCATTGCTTCTGGAATTCCTGCCCCTAAAATTTCCTGGATGAAAGATGGCCGGCCCTTTCT

ACAGACAGAGCAAGTGCAGACTCTAGAAGGAGGAGCTATTCTTCGAGTGTCCAGTGCACAG GTGGAGGATACAGGAAGATACACCTGCCTGGCATCCAG

TCCTGCAGGGGATGATGATAAAGAATATTTAGTGAGAGTACACG TGCCTCCTAATATTGCTGGCATGGATGAAGCCCAGGACTTCACTGTGTTAAGGAA

CAGGCAGGTGACACTGGAATGCAAATCCGATGCGGTGCCTCCACCTGTGATCATGTGGCTCAAAAACAGGGAGCAGTTACAG GCAACACCTCGAGTAAG

AATCCTGTCTGGGGGCAGATACTTACAAATCAATAATGCAGACCTGGGAGACACAGCCAATTACACCTGTGTTGCCAGCAACATCGCGGGAAAGACTACA

AGAGAATTTAACCTCACTGTAAATG TTCCTCCAAGCATCGGTGGCGGTCCCCAGAGCCTTGTCACTCTCTTAAATAAGTCAATCGCCCTGGAATGCCGT

GCTGAAGGCGTGCCAGCACCGAGGATAACGTGGAGAAAGGATGGCGTTGTGCTAGCTGAGAGCCATGCAAG ATATTCCATCTTGGAAAATGGATTCCTT

CATATTGAATCAGCACATGTCACAGATACTGGACGGTATTTGTGTATGGCGACCAATGTGGCTGGAACAGACCGTAGGCGAATAGATTTACAAGTCCATG

 TCCCTCCATCGATTGCTATGGGTCCTACCAACGTAACAGTAACAGTGAATGTCCAAACTACTTTGGCTTGTGAAGCTACTGGGATACCAAAACCATCAG

TCACCTGGAGAAAAAATGGACATCTTCTTAATGTAGATCAAAATCAAAATTCATACAG GCTCCTTTCCTCTGGTTCACTTGTAATCATTTCCCCCTCTG

TGGATGACACTGCCAGTTACGAGTGCACTGTGACAAGCGATGCTGGAGAGGACAAGAGAGCAGTGGACCTCACTGTCCAAG TTCCTCCCACCATAGCGG

ATGAACCTATGGATTTCCTGGTGACCAGACAGGCCCCAGCAGTCATGACCTGCTCAGCTTCTGGAGTTCCTGTTCCCTCAATTCACTGGACCAAAAATGG

CCTAAGACTGCTTCCCAGAGGAGACGGCTATCGGATTCTGTCTTCAG GTGCAATTGAGATACCTACTACCCAATTAAACCACGCAGGAAGATACACGTG

TGTTGCTCGTAATGCAGCGGGCTCAGCACACCGGCATGTAACCCTTCGTGTTCAAG AGCCTCCAGTCATTCAGCCCCAACCAAGTGAACTGGATGTCAT

TCTAAACAACCCAATCTTACTACCATGTGAAGCAACAGGAATACCTACTCCATTCATAACTTGGCAAAAGGAAGGCATCAATGTCATTACCTCAG GCAA

GAGCCTCGCCATTCTTCCTAGTGGCAGCTTACAGATCTCCAGAGCTGTTCGAGGGGATGCAGGCACTTACATGTGTGTGGCCCAGAACCCAGCTGGTACA

GCCTTGGGCAAGGTCAAGCTGAATGTGCAAG TTCCTCCAGTCATTAGTTCTCATCAAAAGGAGTATGTTGTTACAATGGATAAACCTGTCTCTCTACTG

TGTGAGACAGAGGGCTCTCCACCACCTGACATTACCTGGCATAAAGATGGGCATGCACTTACCGAATCTATCCGCCAGCGCATCCTGAATTCAGGGGCTC

TGCAGATAGCATTTGCTCAGCCTGATGATGCTGGTCAGTACACATGCATGGCTGCCAACATGGCCGGATCAAGCAGCGTCAGCAGCACACTCACCGTCCA

TG TACCACCTAGGATTCAAAGCACAGAAGTACACTTCACCGTCAACGAGAACTCCCAAGCTGTTCTCCCGTGCGTTGCTGATGGAATCCCCACGCCTGC

AATTCACTGGGAAAAAGATGGTGTTCTTATAGCCAACTTGTTAGGGAAATACACTGCCCAGCCATATGGAGAGCTCATCTTGGAAAATGTTGTG CTGGA

AGATTCTGGCACCTACACATGTGTCGCTAACAATGCTGCTGGTGAAGATACACGTATTGTGACCCTGGCTGTGCATACCCTTCCCACTTTTACTGAACTT

CCTGGAGACCTGTCATTAAATAAAGGAGAACAGCTACGGTTAAGTTGTAAAGCCGTTGGCATCCCATTGCCCAAACTAACGTGGACCTTCAACAACAATA

TTATTCCAG CCCACTTTGACAGCATCAATGGACACAGTGAACTCGTTATTGAAAAGGTGTCAAAGGAGGACTCGGGCACTTACGTGTGCACCGCGGAGA

ACAGTGTTGGCTTTGTGAAAGCGATCGGATTTGTTTATGTGAAAG AGCCCCCAGTCTTCAAAGGTGATTACCCATCTAACTGGATTGAACCACTCGGAG

GGAACGCAATCCTAAACTGTGAGGTAAAAGGAGACCCTGCCCCAACCATCCAATGGAGCCGCAAGGGGGCTGACATAGAGATTAGCCACAGGATCCGACA

ACTGGGTAATGGTTCCTTGGCCATCTACGGCACTGTG AATGAAGATGCTGGTGACTATACCTGTGTAGCTGCCAATGAGGCCGGGATGGTGGAGCGCAG

CATGAGCCTGACTCTGCAAA GTTCTCCTATTATCACTCTTGAGCCAGTGGAAACTGTTGTAGATGCTGGTGGCAGAGTCATACTGGATTGCCAAGCAGC

TGGTGAACCGCAGCCAACCATCACATGGTCCCGCCAAGGGCAACCCATCTCCTGGGATAACCGACTTTCCATGCTGCCTAACAGCTCATTATACATCGCT

GCTGCTCGTAAGGAAGATACTTCTGAATATGAATGCGTTGCCCGAAACTTGATGGGCTCTGTCCTGGTCAGAGTGCCTGTCATAGTCCAGG TGCACGGT

GGGTTTTCATTGTGGTCTGCCTGGAGGCCCTGCAGTGTCACCTGTGGAAAAGGCATCCAAAAGAGGAGCCGGCTGTGCGACAACCCACCTCCAGCCAATG

GAGGGAGGCCATGCCAAGGGGCGGATTCAGAAGCGCGACACTGTCACAATAAGCTGTGTCCAG TGGATGGTCACTGGTCAGAATGGAGTTTCTGGGAAG

ACTGCTCAAGAAGCTGTGGGCATGGCAACCAAACTAGGACGAGAACTTGCAGCAACCCGCCGGCTCAGCATGGCGGGCGGCCATGCGAGGGGCATGCTGT

GGAAACCATTATGTGTAACATCAGGCCTTGCCCAG TCCATGGTGTGTGGAATGCTTGGCAGCCTTGGAGTGCGTGCAGCAAAAGCTGTGGAAAAGGCAG

TCAGACCAGAATGAGACTTTGCAACAACCCGCCACCGTCATTTGGTGGGGCCCACTGCAGTGGAGCAGAAACCCAGATGCAAGTCTGCAATGAGAGACAC

TGTCCAG TGGATGGCAGGTGGGCGACTTGGAGCAGTTGGAGTGCCTGCACCGTATCCTGCGGAGGAGGTGCCAGGAAGAGAACAAGGGACTGTTCTGAC

CCAGTGCCACAGTATGGAGGAAACAAATGTGAAGGGACTGGTGTCCAGAGTGACTTTTGCAATAGTGACCCTTGTCCAA CCCATGGTAACTGGAGCCCT

TGGAGCGGCTGGGGGACGTGCAGTCGGACATGCAATGGAGGGCAGATGAGGCGGTACCGCACATGTGATAATCCACGTCCCTCCAATGGAGGAAGAGCCT

GTGGGGGTCCAGATACCCAGATCCAGAGGTGCAACACTGACATGTGTCCTG TGGACGGAAGTTGGGGAACATGGCACAGCTGGAGCCACTGTTCTGTCT

CTTGTGGAGGAGGTGAAAGGACTCGAAAGCGACTATGTGACAATCCAGTGCCAACTAAAGGTGGCCGTTCCTGTCCGGGAGATGCCACCCAGGTCTCCAG

ATGTAACATGCAAGCATGTCCAG GTGGACCCCAGCGAGCCAGAGGAAGTGTTATTGGAAATATTAATGATATTGAGTTTGGAATCGCTTTCCTAAATGC

CACAATAACAGATAGCCCTAACACTGATACAAGAGTAATACAGGCCAAGATTACCAATGTGCCTCGCAGTCTTG GTCCAGCAATGAGAAAGATCATTTC

TATCCTAAATCCCATTTACTGGACCACAGCAAAGGAAATAGGGGAAGCAGTTAATGGCTTTACCCTCACTAACGCAGTCTTCAAAAGAGAGACGCAAGTG

GAATTTGCAACTG GAGAGGTCTTGCGGATGACACACGTGGCTCGGGGCTTAGACTCCGACGGCGCCTTGCTGCTTGATGTCATTGTGAGTGGCCAGGTC

CTACAGCTCCACTCACCTGCTGAAGTCGGTGTGAAG GATTACACAGAGGACTACATTCAAACAGGACCCGGTCAGCTCTATGCCTACTCAACTCGTCTG

TTCACCATCGATGGCATCAGTATCCCCTATACGTGGAACCACACCATTTTCTATGATCAGGCCTGGGGGAAAATGCCTTTCTTAGTAGAGACACTTCATG

CATCTTCCATAGAGTCTGACTACAACCAACTAGAAGAGACACTGGGTTTTAAAATCCATGCTTCAATTTCCAAAG GAGATCGCAGTAACCAGTGCCCCT

CTGGGTTCATTTTAGACTCGGTTGGACCCTTTTGTGCAG ATGAAGATGAATGCACAGCTGGGAACCCCTGCTCTCATACCTGCCACAATGCCATAGGAG

CCTATTACTGCTCCTGCCCCAAAGGCCTCACCATAGCTGCAGATGGGAGAACCTGTCAAG ACATTGATGAGTGTGCTTTGGGTGGACATACCTGTCGTG

CTGGTCAGGACTGTGACAACACCATTGGATCCTATCGCTGTGTGGTCCATTGTGGAACAGGCTTCCGAAGAACCTCTGATGGGTTAAGCTGTCAAG ATA

TTAATGAATGTCAGGAGTCCAGCCCCTGTCACCAGCGATGTTTCAACGTCATAGGAAGTTTCCATTGTGGATGTGAAGCTGGCTATCAACTCAAAGGCAG

AAAATGCATCG ATGTGAATGAATGTAGACAGAATGTGTGCAGACCAGACCAGCATTGTAAGAACACCCGCGGTGGCTACAAGTGCATTGATCTTTGTCC

AAGTGGAATGACCAAGGCTGAAAATGGGACCTGCATTG ACATAGATGAGTGCAAAGATGGGACCCATCAGTGCAGATATAACCAAATATGTGAGAACAC

GAGAGGCAGCTACCGGTGTGCATGCCCAAGGGGTTATCGGTCCCAAGGTGTTGGAAGACCCTGTATTG ACATTAATGAATGTGAGCAAGTACCTAAGCC

TTGTGCACATCAGTGCTCCAACAGCCCCGGCAGCTTCAAGTGTATCTGTCTGCCAGGACAGCAGTTGTTAGGGGATGGGAAATCTTGCGCTGGATTGGAG

AGGCTGTCGAATTATGGCACTCAGTACAGTAGCTATACCCTTGAGCGGTTCTCCCCTGTGAGAAGCGACTATCAACCTTCGCAGCATTACAGACAGTACT

CACAACTCTACAGCTCCTACTCAGAGTATAGGAACAGCAGAGCATCTTTCTCCAGGAATAGAAGGACTATTAGGAAAACTTGCCCTGAAGGCTCTGAGGC

AAACCATGAGACATGTGTAG ATATTGATGAATGTCAAAACAGAGACACTTGCCAACACGAGTGTAAAAACACGATCGGGAGCTACCAGTGCGTCTGCCC

ACCAGGTTATCGACTCATGCTCAATGGGAAAACGTGCCAAG ATGTAGATGAGTGCCTGGAGCAGAATGTCCGCTGTGGACCAAATCGAATGTGTTTCAA

CATGAGAGGAAGCTACCAGTGCATCGACACACCCTGCCCACCCAACTACCAACGGGATCCTGTTTTGGG GTTCTGCCTTAAGAACTGTCCACCCAATGA

CTTGGAATGTACCTTAAGCCCATATGCCTTGGAATATAAACTTGTCTCCCTCCCATTTGGAATAGCCGCCAATCAAGATTTAATCCGGCTGGTTGCATAC

ACACAGGATGGCGTGATGCATCCCAGGACAACTTTCCTCATGATAGATGAGGAACCAGCTGTCCCTTTTGCCTTAAGGGATGAAAACCTGAAAGGAGTTG

TGTACACTACACGTCCACTACGAGAGGCAGAGACCTACCGCATGAAGGTGGGAGCTTTATCCTACAGTGCCAATGGGACCATTGAGTATCAGACTACATT

CATAGTTTATATAGCTGTGTCTGCCTATCCGTACTAGGAAGCACTCCAGAATCAAGTCCAAATATTTAAGCTGCATTGATCTAGCCATCGAGGACCTCTA

CAGTTTACTATCTCTTGAACAGTTGCAATCTTGGCAACTTGAAAATGGTGCTGTACTCTGTTACGTATGTTCCTTGGTACTGCTGAAGTATCTGTATGAT

CCCACTATGGTCGTGTATCTTTTAGTAAGTTCTAGAAGCGTCCTTTGTTATTTTCTTTATTTATTACACTGGAGCAGTTACTTCCCAAGGATTATTCTGA

TCAGCTCACAGGACATGTCAGTGACATTGTATAGTAGCATAGTAGCTAAGATCGTTTTCTTGGAAACAATATAAAACAAAACAAAACAGAACTAGTTCAA

ACACTTTTTGAACATTCTGGCTATTCTTAAAATGGTAAAACCAGTTACTATGTGATTTGATAAACGCTTATGCCATAATAATACATTTTTAAAATATTGA

TATAACACTTATACATCTTTCATTTTAAGGTTAAAAAAGAAACAACACTTTTCTGAAATACAGTGCAGATACAAGAAAGTTTGTTTGATCCTAAACAAAC

TTATCTTTATTAAATACTCAAGGTTCTATTAAATTCCCTGAGGTTCTGTGAAATCTTACACTATGGTATCAGAAAGTGACTTTCCCTTTAGATAGTTGCC

CATGGCCTGGGTCTTGACATTTTGGTATAACCATTTATTCACTCAACTCCTTAACTTTTACATTCCATATTTTTCTGTCAAATGAAATTATTTTAAGACA

TAGCAATAGAACAAATTTCTTGATTATTGTAATCATGTATGTTCAAGTTAACGTGTTAAACGTCAATACACTGTACATGGTGGTAACAGACTCTGTAAGC

AATTGTCAAGATGTATTCTATTTTTATGAAGTGTATATATTACCTTAGTGTGTATTTTCTATATTATATCTTGATGGACTCTTTTATAAAATTATTTTAT

AAAAAAAATATTACAGTAAAATAAACCTAAATAAAATGTT
Translation
MIAQEVVHTVFLVALFRSSLAGDGTPQSESRAEEIPEGASTLAFVFDVTGSMYDDLVQVIEGASKILETSLKRPKRPLYNFALVPFHDPE EIGPVTITT

DPKKFQYELRELYVQ GGGDCPEMSIGAIKIALEISLPGSFIYVFTDARSKDYRLTHEVLQLIQQKQSQ - UNI31645 - VVFVLTGDCDDRNHIGY

KVYEEIASTSSGQVFHLDKKQVNE - UNI31645 - VLKWVEEAVQASKVHLLSTDHLEHAVNTWKIPFDPSLKEVTVSLSGPSPVIEIRNPFG - U

NI31645 - GKLIKKGFGLNELLNIHNSAKVVNVKEPEAGMWTVK TSSSGRHSVRITGLSTIDFRAGFSRKPTLDFKKTMSRPVQG GIPTYVLLNTS

GISSPARVDRLELLSISGGSLKTIPVKHYPDRKPYGIWNISDFIPPDEAFFLKVTGYDKDGYLFQRVSSVSFSSIVPD DAPKVTMPTRTLGYYLQPGQI

LCSVESFLPFTLSFMRDGIALGVDQYLR RESASVNWDFTKVTLSDEGFYDCIAVSSAGTGRAQTFFDVSE EPPPIIQLPNNVTVTPGERAVLACLVIS

AVDYNLTWQRSGRDIRLADSARIRTLANLSLELRSVKIGDAGEYRCVVSSEGGSAAASVFLTVQE EKPKVTVMPKNQSFTGGSEISIMCSATGYPKPKI

VWTMNEMFIMGSHR RYRMTSEGTLFIKNAVPKDAGTYACLASNAAGTDKQTSTLRYIE EAPKLVVEQSELLVALGDTTVMECKTSGIPPPQVKWFKG 

GDLELRPSTFLSIDPLVGLLKIQETQDLDAGDYTCVAINEAGRATGRLTLDVGS SPPVFIQEPSDVAVEIGSNVTLPCYVQGYPEPKIKWRRLDNMPVF

SRPFSVSFISQLRTGALFISN NLWASDKGTYICEAENQFGKIQSQTTVTVTGLV VAPLIGISPSMASVIEGQPLTLPCTLLAGNPIPERRWMKNSAM 

LVQNPYITVRSDGSLHIERVRLQDGGKYTCVASNVAGTNNKTTSVAVHV VLPSIQHGQQILSTIEGVPVTLPCRASGIPKPSITWSK KGELISTSSAK

FSAGADGSLYVVSPGSEESGEYICTATNAAGYAKRKVQLTVYV VRPRVFGDQRGLSQDKPVEISVLAGEEAILPCEAKSLPPPIITWAKDSQLISPFSP

R RHTFLPSGSMKITETRVSDSGMYLCVATNIAGNVTQSVKLSVHV VPPKIQHGNRHIKVQVGQRVDILCNAHGSPPPVITWFKSGRPFLDGAQHPGSP

DGTLSIEQAVISDAGVYTCAATNIAGSDEAEVTLHVQE EPPSVEDLQPPFNTPFQERLANQRIEFPCPAKG GTPKPTIKWLHNGREVTGQEPGVSILE

DGALLVIASVTPHNNGEYICVAVNEAGTTERKYNLKVHV VPPVIRDKEHVTNVSVLTSQLASLYCEVEGTPSPVITWYKDDIQ VTESSTVQIVNNGKI

LKLFKVSAEDAGRYSCKAINIAGTSQKDFSVNVLV VPPSILGASSPSEVSVVLNHNVTLQCPGTGVPFPAIHWFKDGK KPLFLGDPNIELSDRGQSLH

LRNARRSDKGRYQCTVSNAAGKQAKDIKLTVYV VPPSIKGGNITTEISALLNSIVKLECETRGLPVPAITWYKDGQVVTSSSQALYIDKGQLLHIQRAQ

VSDSATYTCHAANVAGTAEKSFHVDIYV VPPTIEGDLTAPSNKQVIIGQSLILECKAAGNPPPILTWLKDGVPVKASDNIHIEAGGKKLEILSALEVDR

GQYICVATSVAGEREIKYEVDVLV VPPAVEGGEETSYFIVLANNLLELDCQVSGSPPPTIM MWLKGGQLIDERDGFKILLNGRKLVIAQAQVSDTGLY

QCVATNIAGDHRKEFEVTVHV VPPTIKSSDLPEKTVVRYKPVTLQCIANGIPNPSITWLKDDQPVNTAHGNLK IQSSGRVLQIAKALLEDAGRYTCVA

TNAAGEAHQHTQLHVHE EPPSLDDAGKMRNETVVVNNPIQLECKATGKPLPV VITWYKDSHPLSGSASAAFLKRGQVLEIGSAQISDAGIYKCVAINS

AGATELFYSLQVHV VPPSISGSSSMVEVVVNNLARLECEARGIPAPSLTWLKDGSPVSSFSNGIQ ILSGGRILALTSAQMSDAGRYTCVAVNAAGEKQ

RDIDLRVYA APPNIMGEEQNVSVLIGQAVELFCQSDAVPPPTLMWLKDGRPLLKRPGLSISENGSVLK IEDAQAGDTGRYTCEATNVAGKTEKNYNVN

VWGEYND DIYGSDELVQLTAIEGNLITLLCESSGIPPPDLTWKKKG GSLVLADSAGRVHILSGGRRLQISIAEKADAGLYTCVASNVAGVAKKEYNLQ

VYI IRPSITNSGGHRPEITVIRGKSISLECEVQGIPQPTVTWMKDGRPLTKGKGVEILDEGRILQLKNVHVSDTGRYVCVAVNVAGMTDKRYDLSVHA 

APPSIIGNHGVPENVSVVEKSSVSLTCEASGIPLPSITWLKDGWPVNLGSSVKILSG GGRMLRLMQTRPEDAGQYTCIVRNAAGEDRKMFGLSVLV VP

PHIVGENTLEDVKIKEKQSVTLTCEVRG GNPVPQITWHKDGQLLQEDEAHHMMSGGRFLQITNAQVSHTGRYTCLASNIAGDKSKSFRLNVFV VSPTI

AGVDSDGSPEDVIVILNSPTSLVCEAYSYPPATITWFKDGTPLESNRNIRILPG GGRTLQILNAQEDNAGRYSCVATNEAGEKIKHYEVKVYI IPPII

KKGDLLGPGLSPKEVKIRVNSSLTLECEAYAIPSASLRWYKDGQ PLKSDDHVTIAASGHTLQIKEAQISDTGRYTCVASNLAGEDELDFDVNIQV VPP

SFQKLWEIGNMLDTGRSGEAKDVIINNPLSLHCETNAAPPPTLTWYKDGRPLTSSDRVLILPG GGRVLQIPRAKVEDAGRYTCVAVNEAGEDSLRYDVH

VLL LPPVIKGANSDLPEEVTVLVNKSTQMECSSSGNPAPRNYWQKDGQILLEDEHHKFQSDGRSLQ ILNAQITDTGRYVCVAENTAGSAKKYFNLNVH

V VPPSVIGPNHEHLSVVVNHFISLNCEVSGFPPPDLSWLKNEEPIKPNTNVLTVPG GGRTLQIIRAKISDGGDYTCIAINQAGESKKKVSLTVHV VP

PSIKDHGSQSLSIVNVREGTSVSLECESNAVPPPVITWSKNGRMIPDSTNVEILTGGQTLHIRRAE VSDTGQYVCRAINVAGRDDKNFHLNVYV VPPT

IEGPETEVIVETISNPVTLTCDATGIPPPTITWLKNHKPIE ENSDPLEVHILSGGSKLQIARPQRSNSGNYTCVASNMEGKAQKNFILFIQV VPPSVA

GAEVPSEVSVLLGENVELVCNADGIPTPHLQWLRDGKPIVNGETERVR RVTTDGSTLNIYRALTSDMGKYTCVATNPAGEEDRIFNLNVYV VPPKIRG

NKEEAEKLMALVDTSINIECKATGTPPPQINWLKNGLPLPISSHIRLLSAGQVVR RIVRAQVSDIAVYTCVASNRAGVDSKHYSLQVFV VPPNMDNAM

GTEEITIVKGSSTSMTCFTDGTPAPSMSWLRDGQPLAPDAHLTVSTQGMVLQLIKAETEDTGKYTCVATNEAGEVSKHFVLKVLE EPPHINGSEGPGEV

SVIVNNPLELSCIASGIPAPKISWMKDGRPFLQTEQVQTLEGGAILRVSSAQ VEDTGRYTCLASSPAGDDDKEYLVRVHV VPPNIAGMDEAQDFTVLR

NRQVTLECKSDAVPPPVIMWLKNREQLQ ATPRVRILSGGRYLQINNADLGDTANYTCVASNIAGKTTREFNLTVNV VPPSIGGGPQSLVTLLNKSIAL

ECRAEGVPAPRITWRKDGVVLAESHAR RYSILENGFLHIESAHVTDTGRYLCMATNVAGTDRRRIDLQVHV VPPSIAMGPTNVTVTVNVQTTLACEAT

GIPKPSVTWRKNGHLLNVDQNQNSYR RLLSSGSLVIISPSVDDTASYECTVTSDAGEDKRAVDLTVQV VPPTIADEPMDFLVTRQAPAVMTCSASGVP

VPSIHWTKNGLRLLPRGDGYRILSSG GAIEIPTTQLNHAGRYTCVARNAAGSAHRHVTLRVQE EPPVIQPQPSELDVILNNPILLPCEATGIPTPFIT

WQKEGINVITSG GKSLAILPSGSLQISRAVRGDAGTYMCVAQNPAGTALGKVKLNVQV VPPVISSHQKEYVVTMDKPVSLLCETEGSPPPDITWHKDG

HALTESIRQRILNSGALQIAFAQPDDAGQYTCMAANMAGSSSVSSTLTVHV VPPRIQSTEVHFTVNENSQAVLPCVADGIPTPAIHWEKDGVLIANLLG

KYTAQPYGELILENVV LEDSGTYTCVANNAAGEDTRIVTLAVHTLPTFTELPGDLSLNKGEQLRLSCKAVGIPLPKLTWTFNNNIIPA AHFDSINGHS

ELVIEKVSKEDSGTYVCTAENSVGFVKAIGFVYVKE EPPVFKGDYPSNWIEPLGGNAILNCEVKGDPAPTIQWSRKGADIEISHRIRQLGNGSLAIYGT

V NEDAGDYTCVAANEAGMVERSMSLTLQS SSPIITLEPVETVVDAGGRVILDCQAAGEPQPTITWSRQGQPISWDNRLSMLPNSSLYIAAARKEDTSE

YECVARNLMGSVLVRVPVIVQV VHGGFSLWSAWRPCSVTCGKGIQKRSRLCDNPPPANGGRPCQGADSEARHCHNKLCPV VDGHWSEWSFWEDCSRSC

GHGNQTRTRTCSNPPAQHGGRPCEGHAVETIMCNIRPCPV VHGVWNAWQPWSACSKSCGKGSQTRMRLCNNPPPSFGGAHCSGAETQMQVCNERHCPV 

VDGRWATWSSWSACTVSCGGGARKRTRDCSDPVPQYGGNKCEGTGVQSDFCNSDPCPT THGNWSPWSGWGTCSRTCNGGQMRRYRTCDNPRPSNGGRAC

GGPDTQIQRCNTDMCPV VDGSWGTWHSWSHCSVSCGGGERTRKRLCDNPVPTKGGRSCPGDATQVSRCNMQACPG GGPQRARGSVIGNINDIEFGIAF

LNATITDSPNTDTRVIQAKITNVPRSLG GPAMRKIISILNPIYWTTAKEIGEAVNGFTLTNAVFKRETQVEFATG GEVLRMTHVARGLDSDGALLLDV

IVSGQVLQLHSPAEVGVK DYTEDYIQTGPGQLYAYSTRLFTIDGISIPYTWNHTIFYDQAWGKMPFLVETLHASSIESDYNQLEETLGFKIHASISKG 

GDRSNQCPSGFILDSVGPFCAD DEDECTAGNPCSHTCHNAIGAYYCSCPKGLTIAADGRTCQD DIDECALGGHTCRAGQDCDNTIGSYRCVVHCGTGF

RRTSDGLSCQD DINECQESSPCHQRCFNVIGSFHCGCEAGYQLKGRKCID DVNECRQNVCRPDQHCKNTRGGYKCIDLCPSGMTKAENGTCID DIDE

CKDGTHQCRYNQICENTRGSYRCACPRGYRSQGVGRPCID DINECEQVPKPCAHQCSNSPGSFKCICLPGQQLLGDGKSCAGLERLSNYGTQYSSYTLE

RFSPVRSDYQPSQHYRQYSQLYSSYSEYRNSRASFSRNRRTIRKTCPEGSEANHETCVD DIDECQNRDTCQHECKNTIGSYQCVCPPGYRLMLNGKTCQ

D DVDECLEQNVRCGPNRMCFNMRGSYQCIDTPCPPNYQRDPVLG GFCLKNCPPNDLECTLSPYALEYKLVSLPFGIAANQDLIRLVAYTQDGVMHPRT

TFLMIDEEPAVPFALRDENLKGVVYTTRPLREAETYRMKVGALSYSANGTIEYQTTFIVYIAVSAYPY

For any suggestions or comments, please send an email to unitrap@crg.es