Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000067034 (Zfp97)
Chromosomal location
Chr 17: 17214126 - 17226593 (+)
Description
zinc finger protein 97 Gene [Source:MGI Symbol;Acc:MGI:105921]
RefSeq_peptide
NP_001005358.1 
UniGene
Mm.436633 
MGI
MGI:105921 MGI:3052731 
Uniprot/SPTREMBL
Q3ULR3 Q8VEN0 
Human Ortholog
not available
Omim not available
UniTrap UNI31027
Vector Insertion
Chr 17: 17214156 - 17221710
Public Clones (sanger) 3SD142A11 (ggtc) IST14668B9 (tigm) IST14644H4 (tigm) IST14602C7 (tigm)
IST10086F8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16008
Vector Insertion
Chr 17: 17221960 - 17222484
Public Clones not available
Private Clones OST468165 (lexicon) OST439612 (lexicon) OST434996 (lexicon) OST321321 (lexicon)
OST299787 (lexicon) OST299717 (lexicon) OST276573 (lexicon) OST232372 (lexicon)
OST170431 (lexicon) OST162172 (lexicon) OST141912 (lexicon) OST105470 (lexicon)
OST62114 (lexicon) OST53615 (lexicon) OST39626 (lexicon) OST38913 (lexicon)
OST38012 (lexicon) OST37246 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16023
Vector Insertion
Chr 17: 17222612 - 17222853
Public Clones not available
Private Clones OST467741 (lexicon) OST458726 (lexicon) OST456379 (lexicon) OST453715 (lexicon)
OST449089 (lexicon) OST431189 (lexicon) OST429511 (lexicon) OST414543 (lexicon)
OST412457 (lexicon) OST380914 (lexicon) OST289837 (lexicon) OST263019 (lexicon)
OST252758 (lexicon) OST248002 (lexicon) OST242537 (lexicon) OST240158 (lexicon)
OST234627 (lexicon) OST198985 (lexicon) OST184486 (lexicon) OST179667 (lexicon)
OST176586 (lexicon) OST150852 (lexicon) OST126473 (lexicon) OST112480 (lexicon)
OST109646 (lexicon) OST104660 (lexicon) OST102625 (lexicon) OST98040 (lexicon)
OST84272 (lexicon) OST75682 (lexicon) OST60147 (lexicon) OST57645 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21152
Vector Insertion
Chr 17: 17222915 - 17224207
Public Clones not available
Private Clones OST339824 (lexicon) OST212188 (lexicon) OST178321 (lexicon) OST152531 (lexicon)
OST149112 (lexicon) OST110844 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000097390
Sequence
CTTAGAGTTTCTACTCTAAG GCTAGAG - UNI16008 - AACGCAGTGACGTACTATGATGTCCTGGTGAGCTTTACTCAGGAAGAATGGGCTTTGC

TGGATCCTTCCCAGAAGAGTCTCTACAAAGATGTGATGCTCGAAACCTATAGGAACCTCACTGCCATAG - UNI16023 - GCTATAACTGGGAAGAA

GATAATATTGAAGAAGATTGTGAAAATTCTGGAAGACCCACTAG - UNI21152 - GCATCTTCAAAGGGATGGACCAAGTAATACTGGAGAGAAACC

CTTTGAATGTATTCAATATGATGGAGCCTTTGCAAGAAACCATCATCAGTTACATAAGGACACTGGATCTTTCATGTCTTATACTGATCGTCAAATACAT

AGAAGACCACACACTGAAGAAAAAGTCTATGATGGTAACCAATGTGGTAAAACCTTTTCATGTCACAACCATTTTGAAATCCGTAAAGGAACATATACTG

GAGAAAAACCCTATGAATGTAATCAATGTGGGAAAGCCTTTGCACGCCACAGCAATCTTCTAGACCATAAAAGAATACATACTGGAGAGAAACCCTATAA

ATGTAAGCAATGTGGCAAAGACTTTACCCATCACAGTACTCTTCATATCCATAAAAGAATACATACTAGAGAGAAAACCTATAAATGTAACCAGTGTATG

ACCATTGCTCATCTTCAATGTCATAAAATAACACATACTGGAGAGAAACCCTATGCATGTAAAAAATGTGGCAAAACCTTTGCATATCACAAAACTCTTC

AAATCCATGAAAGAACACATACTGGAGAAAAACTCTATCAATGTAACCAATGTGCCAAAGCCTTTCCATATCACAGAACTCTTCAAATCCATGAAAGAAC

ACATACTGGAGAGAAACCATATGAATGTAATCAATGTGGCAAAGCCTTTGCATGTCTTAGAAATCTTCAAAATCATAAAACAACACATACTGGAGAGAAA

CCCTATGAATGTAACCAGTGTGGCAGAGCCTTTAGACAATATGTTTATCTTCAGTGTCATGAAAGAATACATACTGGAG AGAAACCCTATGAATGTAAA

CAATGTGTCAAAGCCTTTACATGTCACAGTACTCTTCAAATCCGTAAAAGAACACGTACTGGAGAAAAACCCTGTGTATGTAAACAATGTGGCAAAGCCT

TTGCATGTCACAGTACTCCATGAATTCATAAAAGAACACATACTGGAGAGATACCCTATGAATGTAACCAGTGTGGTAAAACCTTTGCACGACACAGTCA

GCTTCAAACACATAAAAGAATACATATTGAAGAAAAACCCGGATAATGCAGTGAATGTGATAAAGGCTTTGTTATTGTAGTCTGAAAAGGAATTTTAAAA

ACAAATTCTTGTGAAAACCCTATAAATGTAATCAATCTAATAAAGCCATTTGTTAGCAGTCACCTTCT
Translation
  - UNI16008 - MLETYRNLTAIG - UNI16023 - GYNWEEDNIEEDCENSGRPTR - UNI21152 - RHLQRDGPSNTGEKPFECIQYDGA

FARNHHQLHKDTGSFMSYTDRQIHRRPHTEEKVYDGNQCGKTFSCHNHFEIRKGTYTGEKPYECNQCGKAFARHSNLLDHKRIHTGEKPYKCKQCGKDFT

HHSTLHIHKRIHTREKTYKCNQCMTIAHLQCHKITHTGEKPYACKKCGKTFAYHKTLQIHERTHTGEKLYQCNQCAKAFPYHRTLQIHERTHTGEKPYEC

NQCGKAFACLRNLQNHKTTHTGEKPYECNQCGRAFRQYVYLQCHERIHTGE EKPYECKQCVKAFTCHSTLQIRKRTRTGEKPCVCKQCGKAFACHSTP
Transcript ENSMUST00000075143
Sequence
CTTAGAGTTTCTACTCTAAG GCTAGAG - UNI16008 - AACGCAGTGACGTACTATGATGTCCTGGTGAGCTTTACTCAGGAAGAATGGGCTTTGC

TGGATCCTTCCCAGAAGAGTCTCTACAAAGATGTGATGCTCGAAACCTATAGGAACCTCACTGCCATAG - UNI16023 - GCTATAACTGGGAAGAA

GATAATATTGAAGAAGATTGTGAAAATTCTGGAAGACCCACTAG - UNI21152 - GCATCTTCAAAGGGATGGACCAAGTAATACTGGAGAGAAACC

CTTTGAATGTATTCAATATGATGGAGCCTTTGCAAGAAACCATCATCAGTTACATAAGGACACTGGATCTTTCATGTCTTATACTGATCGTCAAATACAT

AGAAGACCACACACTGAAGAAAAAGTCTATGATGGTAACCAATGTGGTAAAACCTTTTCATGTCACAACCATTTTGAAATCCGTAAAGGAACATATACTG

GAGAAAAACCCTATGAATGTAATCAATGTGGGAAAGCCTTTGCACGCCACAGCAATCTTCTAGACCATAAAAGAATACATACTGGAGAGAAACCCTATAA

ATGTAAGCAATGTGGCAAAGACTTTACCCATCACAGTACTCTTCATATCCATAAAAGAATACATACTAGAGAGAAAACCTATAAATGTAACCAGTGTATG

ACCATTGCTCATCTTCAATGTCATAAAATAACACATACTGGAGAGAAACCCTATGCATGTAAAAAATGTGGCAAAACCTTTGCATATCACAAAACTCTTC

AAATCCATGAAAGAACACATACTGGAGAAAAACTCTATCAATGTAACCAATGTGCCAAAGCCTTTCCATATCACAGAACTCTTCAAATCCATGAAAGAAC

ACATACTGGAGAGAAACCATATGAATGTAATCAATGTGGCAAAGCCTTTGCATGTCTTAGAAATCTTCAAAATCATAAAACAACACATACTGGAGAGAAA

CCCTATGAATGTAACCAGTGTGGCAGAGCCTTTAGACAATATGTTTATCTTCAGTGTCATGAAAGAATACATACTGGAGAGAAACCCTTTGAATGTAATC

AATGTGGCAAAGCCTTTGCACGTCACAGCACTCTTCAAAGACATAAAAGAACACATACTGGAGAGAAACCCTATGAATGTAATCAATGTGGCAAAGCCTT

TGCATGTCCCAGATACCTTCAAATCCATAAAAGAACACATACTGGAGAGAAACCCTATGAATGTAATCAATGTGGCAAAGCCTTTGCATGTCACAGATAC

CTTCAAATCCATAAAAGAACACATACTGGAGAGAGACCTTATGAATGTAATCAGTGTGGCAAGGCCTTTACATGTCGCAGTAATCTTCAAATCCATAAAA

GAACACATACTGGAGAGAGACCTTATGAATGTAATCAGTGTGGCAAGGCCTTTACATGTCGCAGTAATCTTCAAATCCATAAAAGAACACATACTGGAGA

GAAACCCTATGAATGTAACCAGTGTGGCAAAGCCTTTACACAATTTTTTCCTCTTAAACGTCATGAAATAACACATACCAAAGAGAAACCCTATGAATGT

AACCAGTGTGGCAAAGCCTTTACACGCCACAGTACTCTTCAAATCCATAAAAGAACACATACTGGAGAAAAACCCGTATGAATGTAATCAATGTGGCAAA

GCCTTTGCAGGTCACAGTACTCTTCAAAATCATAAAAGAATACATACTGGAGAGAAGCCCTATGAATTTAACCAGTGTAGCAAAGCTTTTACACAATTTG

TTCATCTTCAGTGTCATCAAAGGTTACATACTGGAGAGAAACCCTATGAATGTAACAATGTGGGAAAGCCTTTGCATGTCACAGTACTCCATGAATTCAT

AAAAGAACACATACTGGAGAGATACCCTATGAATGTAACCAGTGTGGCAAAGCCTTTACACAATTTTTTCATCTTAAACGTCATGAAATAACACATACCA

AAGAGAAACCCTATGAATGTAAACAATGTGGCAAAGCCTTTACACGCCACAGTACTCTTCAAATCCATAAAAGAACACATACTGGAGAAAAACCCGTATG

AATGTAATCAATGTGGCAAAGCCTTTGCAGGTCACAGTACTCTTCAAAATCATAAAAGAATACATACTGGAGAGAAACCCTATGAATTTAACCAGTGTAG

CAAAGCTTTTACACAATTTGTTCATCTTCAGTGTCATCAAAGGTTACATACTGGAGAGAAACCCTATGAATGTAAACAATGTGTCAAAGCCTTTACATGT

CACAGTACTCTTCAAATCCGTAAAAGAACACGTACTGGAGAAAAACCCTGTGTATGTAAACAATGTGGCAAAGCCTTTGCATGTCACAGTACTCCATGAA

TTCATAAAAGAACACATACTGGAGAGATACCCTATGAATGTAACCAGTGTGGTAAAACCTTTGCACGACACAGTCAGCTTCAAACACATAAAAGAATACA

TATTGAAGAAAAACCCGGATAATGCAGTGAATGTGATAAAGGCTTTGTTATTGTAGTCTGAAAAGGAATTTTAAAAACAAATTCTTGTGAAAACCCTATA

AATGTAATCAATCTAATAAAGCCATTTGTTAGCAGTCACCTTC
Translation
LRVSTLR RLE - UNI16008 - NAVTYYDVLVSFTQEEWALLDPSQKSLYKDVMLETYRNLTAIG - UNI16023 - GYNWEEDNIEEDCENSGR

PTR - UNI21152 - RHLQRDGPSNTGEKPFECIQYDGAFARNHHQLHKDTGSFMSYTDRQIHRRPHTEEKVYDGNQCGKTFSCHNHFEIRKGTYTGE

KPYECNQCGKAFARHSNLLDHKRIHTGEKPYKCKQCGKDFTHHSTLHIHKRIHTREKTYKCNQCMTIAHLQCHKITHTGEKPYACKKCGKTFAYHKTLQI

HERTHTGEKLYQCNQCAKAFPYHRTLQIHERTHTGEKPYECNQCGKAFACLRNLQNHKTTHTGEKPYECNQCGRAFRQYVYLQCHERIHTGEKPFECNQC

GKAFARHSTLQRHKRTHTGEKPYECNQCGKAFACPRYLQIHKRTHTGEKPYECNQCGKAFACHRYLQIHKRTHTGERPYECNQCGKAFTCRSNLQIHKRT

HTGERPYECNQCGKAFTCRSNLQIHKRTHTGEKPYECNQCGKAFTQFFPLKRHEITHTKEKPYECNQCGKAFTRHSTLQIHKRTHTGEKPV
Transcript ENSMUST00000115587
Sequence
CTACCTGTCCTCTCCCTAAAAAAAACCAAT - UNI16008 - - UNI31027 - AACGCAGTGACGTACTATGATGTCCTGGTGAGCTTTACTCAGG

AAGAATGGGCTTTGCTGGATCCTTCCCAGAAGAGTCTCTACAAAGATGTGATGCTCGAAACCTATAGGAACCTCACTGCCATAG - UNI16023 - GC

TATAACTGGGAAGAAGATAATATTGAAGAAGATTGTGAAAATTCTGGAAGACCCACTAG - UNI21152 - GCATCTTCAAAGGGATGGACCAAGTAA

TACTGGAGAGAAACCCTTTGAATGTATTCAATATGATGGAGCCTTTGCAAGAAACCATCATCAGTTACATAAGGACACTGGATCTTTCATGTCTTATACT

GATCGTCAAATACATAGAAGACCACACACTGAAGAAAAAGTCTATGATGGTAACCAATGTGGTAAAACCTTTTCATGTCACAACCATTTTGAAATCCGTA

AAGGAACATATACTGGAGAAAAACCCTATGAATGTAATCAATGTGGGAAAGCCTTTGCACGCCACAGCAATCTTCTAGACCATAAAAGAATACATACTGG

AGAGAAACCCTATAAATGTAAGCAATGTGGCAAAGACTTTACCCATCACAGTACTCTTCATATCCATAAAAGAATACATACTAGAGAGAAAACCTATAAA

TGTAACCAGTGTATGACCATTGCTCATCTTCAATGTCATAAAATAACACATACTGGAGAGAAACCCTATGCATGTAAAAAATGTGGCAAAACCTTTGCAT

ATCACAAAACTCTTCAAATCCATGAAAGAACACATACTGGAGAAAAACTCTATCAATGTAACCAATGTGCCAAAGCCTTTCCATATCACAGAACTCTTCA

AATCCATGAAAGAACACATACTGGAGAGAAACCATATGAATGTAATCAATGTGGCAAAGCCTTTGCATGTCTTAGAAATCTTCAAAATCATAAAACAACA

CATACTGGAGAGAAACCCTATGAATGTAACCAGTGTGGCAGAGCCTTTAGACAATATGTTTATCTTCAGTGTCATGAAAGAATACATACTGGAGAGAAAC

CCTTTGAATGTAATCAATGTGGCAAAGCCTTTGCACGTCACAGCACTCTTCAAAGACATAAAAGAACACATACTGGAGAGAAACCCTATGAATGTAATCA

ATGTGGCAAAGCCTTTGCATGTCCCAGATACCTTCAAATCCATAAAAGAACACATACTGGAGAGAAACCCTATGAATGTAATCAATGTGGCAAAGCCTTT

GCATGTCACAGATACCTTCAAATCCATAAAAGAACACATACTGGAGAGAGACCTTATGAATGTAATCAGTGTGGCAAGGCCTTTACATGTCGCAGTAATC

TTCAAATCCATAAAAGAACACATACTGGAGAGAGACCTTATGAATGTAATCAGTGTGGCAAGGCCTTTACATGTCGCAGTAATCTTCAAATCCATAAAAG

AACACATACTGGAGAGAAACCCTATGAATGTAACCAGTGTGGCAAAGCCTTTACACAATTTTTTCCTCTTAAACGTCATGAAATAACACATACCAAAGAG

AAACCCTATGAATGTAACCAGTGTGGCAAAGCCTTTACACGCCACAGTACTCTTCAAATCCATAAAAGAACACATACTGGAGAAAAACCCGTATGAATGT

AATCAATGTGGCAAAGCCTTTGCAGGTCACAGTACTCTTCAAAATCATAAAAGAATACATACTGGAGAGAAGCCCTATGAATTTAACCAGTGTAGCAAAG

CTTTTACACAATTTGTTCATCTTCAGTGTCATCAAAGGTTACATACTGGAGAGAAACCCTATGAATGTAACAATGTGGGAAAGCCTTTGCATGTCACAGT

ACTCCATGAATTCATAAAAGAACACATACTGGAGAGATACCCTATGAATGTAACCAGTGTGGCAAAGCCTTTACACAATTTTTTCATCTTAAACGTCATG

AAATAACACATACCAAAGAGAAACCCTATGAATGTAAACAATGTGGCAAAGCCTTTACACGCCACAGTACTCTTCAAATCCATAAAAGAACACATACTGG

AGAAAAACCCGTATGAATGTAATCAATGTGGCAAAGCCTTTGCAGGTCACAGTACTCTTCAAAATCATAAAAGAATACATACTGGAGAGAAACCCTATGA

ATTTAACCAGTGTAGCAAAGCTTTTACACAATTTGTTCATCTTCAGTGTCATCAAAGGTTACATACTGGAGAGAAACCCTATGAATGTAAACAATGTGTC

AAAGCCTTTACATGTCACAGTACTCTTCAAATCCGTAAAAGAACACGTACTGGAGAAAAACCCTGTGTATGTAAACAATGTGGCAAAGCCTTTGCATGTC

ACAGTACTCCATGAATTCATAAAAGAACACATACTGGAGAGATACCCTATGAATGTAACCAGTGTGGTAAAACCTTTGCACGACACAGTCAGCTTCAAAC

ACATAAAAGAATACATATTGAAGAAAAACCCGGATAATGCAGTGAATGTGATAAAGGCTTTGTTATTGTAGTCTGAAAAGGAATTTTAAAAACAAATTCT

TGTGAAAACCCTATAAATGTAATCAATCTAATAAAGCCATTTGTTAGCAGTCACCTTC
Translation
LPVLSLKKTN - UNI16008 - - UNI31027 - NAVTYYDVLVSFTQEEWALLDPSQKSLYKDVMLETYRNLTAIG - UNI16023 - GYNWEE

DNIEEDCENSGRPTR - UNI21152 - RHLQRDGPSNTGEKPFECIQYDGAFARNHHQLHKDTGSFMSYTDRQIHRRPHTEEKVYDGNQCGKTFSCHN

HFEIRKGTYTGEKPYECNQCGKAFARHSNLLDHKRIHTGEKPYKCKQCGKDFTHHSTLHIHKRIHTREKTYKCNQCMTIAHLQCHKITHTGEKPYACKKC

GKTFAYHKTLQIHERTHTGEKLYQCNQCAKAFPYHRTLQIHERTHTGEKPYECNQCGKAFACLRNLQNHKTTHTGEKPYECNQCGRAFRQYVYLQCHERI

HTGEKPFECNQCGKAFARHSTLQRHKRTHTGEKPYECNQCGKAFACPRYLQIHKRTHTGEKPYECNQCGKAFACHRYLQIHKRTHTGERPYECNQCGKAF

TCRSNLQIHKRTHTGERPYECNQCGKAFTCRSNLQIHKRTHTGEKPYECNQCGKAFTQFFPLKRHEITHTKEKPYECNQCGKAFTRHSTLQIHKRTHTGE

KPV

For any suggestions or comments, please send an email to unitrap@crg.es