Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000067285 (EG433882)
Chromosomal location
Chr 5: 42459199 - 42608023 (+)
Description
predicted gene, EG433882 Gene [Source:MGI Symbol;Acc:MGI:3648966]
UniGene
Mm.319353 
MGI
MGI:3648966 
Uniprot/SPTREMBL
Q8CBM3 
Human Ortholog
not available
Omim not available
UniTrap UNI30776
Vector Insertion
Chr 5: 42459318 - 42596011
Public Clones IST14315E1 (tigm) IST10887E8 (tigm) IST10562B10 (tigm) IST12031D7 (tigm)
IST14317G8 (tigm) IST13610E5 (tigm) IST10092H5 (tigm) IST14855B6 (tigm)
IST14328A7 (tigm) IST12775E12 (tigm) IST14427D1 (tigm) IST11024E10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000087332
Sequence
TGTTCTGCACTGTCCTCTTTTCCACAGAGATTCTGGAGACAGACGCTGCCATCAGGTGATCTACAGGTGTGGAGTTGTAGCCCCAGAGGTTTTGGAGGAG

AGCGTACTGGACTCACAGG - UNI30776 - GGAAGGTGGACAGGAAACTGGCGTTCGGACCTGCCTCCTGACAGAAGATGAAGGCCTGAAACAGGGC

TTGTCCCAGAATCTGTGTAGCTTCTGTAGTCCACACTCTCACCTGTGCAGACTAGTCTCTGCGGAATCTGGGAACCAAGATGGCTCCCCCAGGTGCTGTG

GCAAAGCCTTCCTGGGTGGGGCAGACACCTATCCTCTGGCAG CATGCTGCTTTCACCTGATGGTATGATACTACTGTGGATTTCATAATCAGAGATGCA

TAAAAGCTAATAGGAAGCAAAGTAGATAAAAGGACCATGTGTTCGCTGTAGCTTCTGACAAGGCACAAGCTACCACTTCCACACAACGACACATCATCCT

AATGACTGGAAAACAAGACAGCATCTGACTACAACTGCCCGAGGAACCCTGACTGAGGGCATGCAGCTGAGAACAGTCTCACTGTGAGCTAGAGAAGCAC

AGGAAATGATCACTGCTGTACAGCGCTGAGATCTGAGTGATTTGCTTCACAGCAATAAAAAGTAAATTGATTTGGAGATTCAGAAATAGCAGAAGATGTG

CAGTCCCAGTGCAGATGTTTACAGGCTGTGATGATGGGTGAGTTAACAGCTTGCTCCAGAGAATAGGGTTAATGGTGGACATGGAAGTAAGAGGAGAAAA

TGAAACACTGCTTTGCAATCCCTTTGTAATCTTCAGAAGTGTAAGCAATAGCATTGTGATTTGATCAAGGTTGCACAGTTGGGTCTCACAGTGCCCAAAC

TAGGGTTTGAGGCTTTTCATTATGAGATTTTGTTCAGATTCCTCCCTTGTTCTTCCTGAGCAGCTACTGAAAACCTGAGTTTACTCTAGCTATTGGGACA

ATTCAAAATGATAGTGGTTATTAAAGTAACAACAAATACTGAAAATATGCTGTTGATAATGGGTATATTTTCACAACCCATGCCCTGTGCATGCACATAC

TCCCATCCTGTGTTATTCTGAATTTGAGGATAGATCACTATTAAGGTCCTGGAAAACACCAGGAACTGTGCTGAGTTATCCATATGTATGACCACATTTT

TCTCCTAGGGCAGAAGAGAACCCAAGGGTTCTTTTTGACTTTCTCAGCATCCTGCTCCTCAGCATGCCTGTTTTTCTGTGATTAGCCACTTTTTATTCAT

TGTTTCTGGATGTGTGCATAATGAAAATTTTCATCAAAAGTCTGTAAAGTACACCTTGCATTGTCCAACACTAGCCAAGGGGTTGGGTACATCAGATTCT

TCTTAATGGAATTGACCTGAGTACAGCTTCATGCATAAGGCAGTTACTAGGATATTAGCACCTAACAGTTGTGTCTTAGAACTTCCATCTTCTGCCTCTG

GGTTAATAATTCATGTGAGAGGTTCCAGCTTACGAAGAGTGACACAATTCATGGGCAGGTAGGACTGTGCTCTGTAACAAATCTAGCAGAAAGCAAGCTA

GTAAGCAATGTCTTCCCATTGTCTTTTCTTCCATTCCTGTTTCTGGCTTTCTTACCCAGACTTCCCTCAGTGATGTTACATGAAAGTATAAGGTAAAGCA

AACCTCTTCCTTCTCAAATTGCTTTTGTCTGCTAATATTTGTTATCACATTTAAAAATCTGTCTCATCAAGTATTATGCAGAATCAACAAAGTCTATTTT

CTTACAGGATTTCTTAATTTAATCTCATAAATCTCTAGTGAATATTGTAGATAACTATGTTTTAGTACAAGAATTGGATTCAATAGGAAGTCTTCATAGA

AGGCTTAATCTTTATAGCCATTTATTACCAAAGTTCAGGCCTATGTAGTGAATGGGTAGTTGGCAGACATTCACTCTGTAAGACAAATGCTTCATGATTC

ATTTAGGGACCTAGAAATATTATGTGATAATGTATAAATATCATCCAAAAGGCTTTCTGCCCTATATTTTTAAAATACAGAAGTTATATTTGAAGTAGTC

CTGGCCCTAGTTCTATAGGGCTTGGCTATGTAATATGTTTATGGAAGAAACGTTTAGTTCTGGAAAAGGTAAATACTTGTATATAATTTTGCAGCCCTGG

AGTCTCCCAACTCCATTTCTTCCTTTAATTTAATTGATCACTTGTATATGTCTTCCCTGCTGTGTTAGAAAAACAGGGGCTGGATATCCCAGGAGTCAGA

ATGTATATAAGATAATGCACCTAAACAGCAGGCACATTTACCAGATGCTCTCAAATTTTGGTCCAAAATGAGTATTTGGGAATAGATTTATTGTGAATGT

TTAATTAGCGATTTTCCTTAAATTTGGACTAAGTTGTTTTTAAGACTTTTTTCTTTGTAAGCGTCATAAATGCTAATCAACCTGTTAAGTTATTTTTTCT

TACTGCATGTTACATTGAAATAAAAACAGAG
Translation
CSALSSFPQRFWRQTLPSGDLQVWSCSPRGFGGERTGLTG - UNI30776 - GEGGQETGVRTCLLTEDEGLKQGLSQNLCSFCSPHSHLCRLVSAES

GNQDGSPRCCGKAFLGGADTYPLAA ACCFHLMV

For any suggestions or comments, please send an email to unitrap@crg.es