Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000067336 (Bmpr2)
Chromosomal location
Chr 1: 59821481 - 59927703 (+)
Description
bone morphogenic protein receptor, type II (serine/threonine kinase) Gene [Source:MGI Symbol;Acc:MGI:1095407]
RefSeq_dna
NM_007561 
RefSeq_peptide
NP_031587.1 
MGI
MGI:1095407 
Uniprot/SWISSPROT
O35607 
Uniprot/SPTREMBL
Q3UER5 Q3UG09 Q3UU71 
Human Ortholog
ENSG00000204217 (BMPR2)
Omim 178600 - PULMONARY HYPERTENSION, PRIMARY  265450 - PULMONARY VENOOCCLUSIVE DISEASE  
UniTrap UNI3697
Vector Insertion
Chr 1: 59904017 - 59908021
Public Clones XT0547 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3699
Vector Insertion
Chr 1: 59916154 - 59920624
Public Clones XT0522 (sanger) XT0545 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000087435
Sequence
CTTTGCTGGCCCAGGGATGACTTCCTCGCTGCATCGGCCCTTTCGGGTGCCCTGGCTGCTATGGGCCGTCCTGCTGGTCAGCACTACGGCTG CTTCTCA

GAATCAAGAACGGCTGTGTGCATTTAAAGATCCATATCAACAAGATCTTGGGATAGGTGAGAGTCGAATCTCTCATGAAAATGGGACAATATTATGTTCC

AAAGGGAGCACGTGTTATGGTCTGTGGGAGAAATCAAAAGGGGACATCAATCTTGTGAAACAAG GATGTTGGTCTCACATCGGTGATCCCCAAGAGTGC

CACTATGAAGAGTGTGTAGTAACTACCACCCCACCCTCAATTCAGAATGGAACGTACCGCTTTTGCTGCTGTAGTACAGATTTATGTAATGTCAACTTTA

CTGAGAACTTTCCACCCCCTGACACAACACCACTCA GTCCACCTCATTCATTTAATCGAGATGAAACGATAATCATTGCTTTGGCATCAGTTTCTGTGT

TAGCTGTTTTGATAGTCGCCTTATGTTTTGGATACAGAATGTTGACAG GAGACCGGAAACAGGGTCTTCACAGCATGAACATGATGGAGGCGGCAGCAG

CAGAGCCCTCCCTTGACCTGGATAACCTGAAGCTGCTGGAG CTGATTGGACGGGGTCGATACGGAGCAGTATATAAAGGTTCCTTGGATGAGCGTCCAG

TTGCTGTAAAAGTATTTTCTTTTGCAAACCGTCAGAATTTTATAAATGAAAAAAACATTTACAGAGTGCCTTTGATGGAACATGACAACATTGCTCGCTT

CATAGTTGGAGACGAGAGGCTCACTGCAGACGGCCGCATGGAGTATTTGCTTGTGATGGAGTATTATCCCAAT GGATCTCTGTGCAAATATCTGAGTCT

CCACACAAGTGATTGGGTAAGCTCTTGCCGTCTGGCTCATTCTGTGACTAGAGGACTGGCTTATCTTCACACAGAATTACCACGAGGAG - UNI3697 

- ATCATTATAAACCCGCAATCTCCCACCGAGATTTAAACAGCAGGAATGTCCTGGTAAAGAATGACGGCGCGTGTGTTATCAGTGACTTTGGTTTATCC

ATGAGGCTAACTGGAAATCGGCTGGTGCGCCCAGGGGAAGAAGATAATGCGGCTATAAGTGAG GTTGGCACAATTCGCTATATGGCACCAGAAGTGCTA

GAAGGAGCTGTGAACCTGAGGGACTGTGAGTCAGCTCTGAAGCAAGTGGACATGTATGCGCTTGGACTCATCTACTGGGAGGTGTTTATGAGGTGTACAG

ACCTCTTCCCAG GTGAATCTGTACCAGATTACCAGATGGCTTTTCAGACAGAAGTTGGAAACCATCCCACATTTGAGGATATGCAGGTTCTTGTGTCCA

GAGAGAAGCAGAGACCCAAGTTCCCAGAAGCCTGGAAAGAAAATAGCCTG - UNI3699 - GCAGTGAGGTCACTCAAGGAAACAATTGAAGACTGCT

GGGACCAGGATGCAGAGGCTCGGCTCACTGCACAGTGTGCTGAGGAGAGGATGGCTGAACTCATGATGATATGGGAGAGAAACAAGTCTGTGAGCCCAAC

GGTCAACCCAATGTCAACTGCTATGCAGAATGAACG CAACCTGTCACATAATAGGCGTGTGCCAAAAATCGGGCCTTACCCAGATTATTCCTCTTCCTC

ATATATTGAAGACTCTATCCATCATACTGACAGCATTGTGAAGAATATTTCCTCTGAGCATTCGATGTCCAGCACACCATTGACAATAGGAGAAAAGAAT

CGAAATTCAATTAATTATGAACGACAGCAAGCACAAGCTCGAATCCCTAGCCCAGAAACAAGCGTCACAAGCCTGTCCACAAACACAACCACCACAAACA

CCACCGGCCTCACTCCAAGTACTGGCATGACCACTATATCTGAGATGCCATACCCAGATGAGACACATTTGCACGCCACAAATGTTGCACAGTCAATCGG

GCCAACCCCTGTCTGCTTACAGCTGACAGAAGAAGACTTGGAGACTAATAAGCTAGATCCAAAAGAAGTTGATAAGAACCTCAAGGAAAGCTCTGATGAG

AATCTCATGGAGCATTCTCTGAAGCAGTTCAGTGGGCCAGACCCATTGAGCAGTACCAGTTCTAGCTTGCTTTATCCACTCATAAAGCTCGCAGTGGAAG

TGACTGGACAACAGGACTTCACACAGGCTGCAAATGGGCAAGCATGTTTAATTCCTGATGTTCCACCTGCTCAGATCTATCCTCTCCCTAAGCAACAGAA

CCTTCCTAAGAGACCTACTAGTTTGCCTTTGAACACCAAAAATTCAACAAAAGAACCCCGGCTAAAATTTGGCAACAAGCACAAATCAAACTTGAAACAA

GTAGAAACTGGAGTTGCCAAGATGAATACAATCAATGCAGCAGAGCCTCATGTGGTGACAGTAACTATGAATGGTGTGGCAGGTAGAAGCCACAATGTTA

ATTCCCATGCTGCCACAACCCAGTATGCCAATGGCGCAGTGCCAGCTGGCCAGGCAGCCAACATAGTGGCACATAGGTCCCAAGAAATGCTGCAGAATCA

ATTTATTGGTGAGGATACCAGGCTGAATATCAATTCCAGTCCTGATGAGCATGAACCTTTACTGAGACGAGAGCAACAGGCTGGCCATGATGAAGGGGTT

CTGGATCGTTTGGTAGATAGGAGGGAACGGCCATTAGAAGGTGGCCGAACAAATTCCAATAACAACAACAGCAATCCATGTTCAGAACAAGATATCCTTA

CACAAGGTGTTACAAGCACAGCTGCAGATCCTGGGCCATCAAAGCCCAGAAGAGCACAGAGGCCCAATTCTCTGGATCTTTCAGCCACAAATATCCTGGA

TGGCAGCAGTATACAGA TAGGTGAGTCAACACAAGATGGCAAATCAGGATCAGGTGAAAAGATCAAGAGACGTGTGAAAACTCCATACTCTCTTAAGCG

GTGGCGCCCGTCCACCTGGGTCATCTCCACCGAGCCGCTGGACTGTGAGGTCAACAACAATGGCAGTGACAGGGCAGTCCATTCTAAATCTAGCACTGCT

GTGTACCTTGCAGAGGGAGGCACTGCCACGACCACAGTGTCTAAAGATATAGGAATGAATTGTCTGTGAGATGTTTTCAAGCTTATGGAGTGAAATTATT

TTTTTGCATCATTTAAACATGCAGAAGACATTTAAAAAAAAAACTGCTTTAACCTCCTGTCAGCACCCCTTCCCACCCCTGCAGCAAGGACTTGCTTTAA

ATAGATTTCAGCTATGCAGAAAATTTTAGCTTATGCTTCCATAATTTTTAATTTTGTTTTTTAAGTTTTGCACTTTTGTTTAGTCTTGCTAAAGTTATAT

TTGTCTGTTATGACCACATTATATGTGTGCTTATCAAAAGTGGTCTCAAAATATTTTTTTAAGAAAAAAGCAAAAACAATGGATTGCTGATAATCAGTTT

GGACCATTTTCTAAAGGTCATTAAAACAGAAGCAAATTCAGAC
Translation
MTSSLHRPFRVPWLLWAVLLVSTTAA ASQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQG GCWSHIGDPQECHY

EECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLS SPPHSFNRDETIIIALASVSVLAVLIVALCFGYRMLTG GDRKQGLHSMNMMEAA

AAEPSLDLDNLKLLE LIGRGRYGAVYKGSLDERPVAVKVFSFANRQNFINEKNIYRVPLMEHDNIARFIVGDERLTADGRMEYLLVMEYYPN GSLCKY

LSLHTSDWVSSCRLAHSVTRGLAYLHTELPRGD - UNI3697 - DHYKPAISHRDLNSRNVLVKNDGACVISDFGLSMRLTGNRLVRPGEEDNAAISE

 VGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEVFMRCTDLFPG GESVPDYQMAFQTEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSL -

 UNI3699 - AVRSLKETIEDCWDQDAEARLTAQCAEERMAELMMIWERNKSVSPTVNPMSTAMQNER RNLSHNRRVPKIGPYPDYSSSSYIEDSIHH

TDSIVKNISSEHSMSSTPLTIGEKNRNSINYERQQAQARIPSPETSVTSLSTNTTTTNTTGLTPSTGMTTISEMPYPDETHLHATNVAQSIGPTPVCLQL

TEEDLETNKLDPKEVDKNLKESSDENLMEHSLKQFSGPDPLSSTSSSLLYPLIKLAVEVTGQQDFTQAANGQACLIPDVPPAQIYPLPKQQNLPKRPTSL

PLNTKNSTKEPRLKFGNKHKSNLKQVETGVAKMNTINAAEPHVVTVTMNGVAGRSHNVNSHAATTQYANGAVPAGQAANIVAHRSQEMLQNQFIGEDTRL

NINSSPDEHEPLLRREQQAGHDEGVLDRLVDRRERPLEGGRTNSNNNNSNPCSEQDILTQGVTSTAADPGPSKPRRAQRPNSLDLSATNILDGSSIQI I

GESTQDGKSGSGEKIKRRVKTPYSLKRWRPSTWVISTEPLDCEVNNNGSDRAVHSKSSTAVYLAEGGTATTTVSKDIGMNCL

For any suggestions or comments, please send an email to unitrap@crg.es