Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000067369 (4732479N06Rik)
Chromosomal location
Chr X: 130757494 - 130811523 (-)
Description
TRM2 tRNA methyltransferase 2 homolog B (S. cerevisiae) Gene [Source:MGI Symbol;Acc:MGI:2442530]
RefSeq_dna
NM_172540 
RefSeq_peptide
NP_766128.1 
MGI
MGI:2442530 
Uniprot/SWISSPROT
Q8BQJ6 
Uniprot/SPTREMBL
Q8C8J3 
Human Ortholog
ENSG00000188917 (CXorf34)
Omim not available
UniTrap UNI33169
Vector Insertion
Chr X: 130805048 - 130811460
Public Clones IST12965E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24272
Vector Insertion
Chr X: 130801869 - 130802101
Public Clones not available
Private Clones OST226209 (lexicon) OST77786 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27517
Vector Insertion
Chr X: 130800855 - 130801869
Public Clones not available
Private Clones OST57702 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000087540
Sequence
GAGGAGCCTGAGCAGGCGGGCTGGAGCGCTGCGCACCAGGAAGTGACTGGCCCCTGCAACCCCTTCGCGCCATCCGCTGGTATTTTAGTTTGCCACTGCA

CGTCCGTCCAAGGCCTTAGTGACTCCCAAGGAGTCCCGG - UNI24272 - - UNI33169 - GCATCAAGAGTCCTAAATGCACAACCCAAGACTA

TTCCTTTCCAGAGCGGGTTTCTTCTCCAAACCAGGACTGCTTCCCTGGGATACTGGAAGACCACCAGATTTGTCACAGTCCTTATTGGGCAGAGCATATA

AAGGGAGTTTCACCAGCGTGATAGCTAAGAAGCACCCAAGCAGACAAAAATATCAGAAGAAACAAAGGCATTGTAGAGATGACTCCTGGCAGGAGAG - 

UNI24272 - - UNI27517 - GCTGGCTGATGTTGTGACTCCACTCTGGAGGCTGAGTTATGAAGCACAACTCAAG CCTACCACCACTGGCTACCG

GAACAAGTCCACCTTTTCTGTGTACAGGAGCCCAGATGGCAATCCAAAGACTGTGGGCTACTACCTAGGAACTTGGAAAGGTCAGTTCTAAACAAAACTA

AACCAAAAACAAACAAACAAACAAACAAAAAACCCAAAAAGCTAAACAGTGATGGAGAAGGAAGAAGAGGTACACGTAGCAGTGTCAACAAGCGTGGACC

ACTCGGTGACCATAAAGAAGGCTGACTGCTTCAGCGCAGCGCAGGCACACAAGGTTGATCTGGGTTAATTTCTGATGATTATAACCGGGAAAGATATTAC

TGCTCTTGCCTATTCTTCCTCTAAATGTAATTTACCAGCTAGGCCAGCAAAGGCCTCGAGTAAACGCTTCTGTTGTC
Translation
 - UNI24272 - - UNI33169 - MHNPRLFLSRAGFFSKPGLLPWDTGRPPDLSQSLLGRAYKGSFTSVIAKKHPSRQKYQKKQRHCRDDSWQER 

- UNI24272 - - UNI27517 - RLADVVTPLWRLSYEAQLK PTTTGYRNKSTFSVYRSPDGNPKTVGYYLGTWKGQF
Transcript ENSMUST00000113254
Sequence
GACTGGCCCCTGCAACCCCTTCGCGCCATCCGCTGGTATTTTAGTTTGCCACTGCACGTCCGTCCAAGGCCTTAGTGACTCCCAAGGAGTCCCGG - UN

I24272 - - UNI33169 - GCATCAAGAGTCCTAAATGCACAACCCAAGACTATTCCTTTCCAGAGCGGGTTTCTTCTCCAAACCAGGACTGCTTCC

CTGGGATACTGGAAGACCACCAGATTTGTCACAGTCCTTATTGGGCAGAGCATATAAAGGGAGTTTCACCAGCGTGATAGCTAAGAAGCACCCAAGCAGA

CAAAAATATCAGAAGAAACAAAGGCATTGTAGAGATGACTCCTGGCAGGAGAG - UNI24272 - - UNI27517 - GCTGGCTGATGTTGTGACTC

CACTCTGGAGGCTGAGTTATGAAGCACAACTCAAG CCTACCACCACTGGCTACCGGAACAAGTCCACCTTTTCTGTGTACAGGAGCCCAGATGGCAATC

CAAAGACTGTGGGCTACTACCTAGGAACTTGGAAAG ATGGAAATGTCGTCTGTCTACCATGTAATCATCTGAAAAACATCCCAGAGAAACACAGTCAAG

TGGCTCAG TACTATGAAGTATTCCTTCGACAGTCTTCAGTGGAACCCTGCCTTCTCTTTCATGAAGGTGGACACTGGCGTGAACTCGTAGTTCGTACCA

ATAGGCAAGGACACACAATGGCTATTGTCACTTTTCATCCCCAGGGATTAAGTGAG GAGGAGGTCTGTGTTCAGAAGGTGACCTTGAAGGATTTTTTCA

CTAAAGGCCCTGGAGCGATCTGTGAATTGACCTCGCTCTATTTCCAGGAAAG CACCATGACCCGTTGCAGCCATCAGCAGTCCCCCTACCAGCTCCTGT

TTGGGGAGCCCCACATCTTTGAGGATCTTCTGGGTTTGAAGATTCGAATTTCTCCAGATGCCTTCTTCCAGATTAATACTGCTGGGGCAGAGATGCTGTA

TCGGATCATTGGGGAGCTGAGTGGAGTGAACTCTGAGAGCCTCCTCCTAGACATTTGCTGTGGCACGG GTGTGATTGGCCTCTCTGTGGCTCAGCGTGC

CTCCCAGGTTCATGGCATTGAGCTAGTGGAGCAGGCAGTAGAGGATGCCAGGTGGACTGCAGCCTTCAATG GTGTCACCAACTGTGAGTTTCACGCTGG

CAGAGCAGAGACGATTTTGCCACAGCTGTTAAAGTCACAGAAAGATGAGAAGTTGACTGTTGCTGTGGTGAACCCTGCCCGAGCTGGATTGC ATTACAG

AGTGGTGCGAGCCATTCGGAACTGCAGGACCATCCACACTCTAGTGTTTGTTTCCTGCAAGCCCCATGGTGAAAGCACAAGGAACTTCATTGA ACTATG

CTGTCCTCCAAATTCTGCAAAGCAGCTCCTAGGTGATCCATTCGTCCTGAGAGAAGCTGTACCTGTGGATTTGTTTCCCCACACCCCACACTGTGAGCTG

GTTCTCCTCTTCACTCGGTAAGACCTGGACGCTGCAGGCTGATAAGGCTGAAGTTTCCGAGACACCCAGGTTGCCATAGGAGACAGTGGAAGCATCACCA

GAAAGACCAATTTTGAATCCTGGCCAAAAGAATTTGACTGGCCTCCTTCTCTGAGGCAGATTGGACTGTAGCTTGTCCTAGTCCTTTGGGGTTATCCATA

TTCCCTTAGCTTTGATTGCTCCTAACTCCTTGAACCTGAATTTGTGTTGCTCCATCCTTTTGCTGTCTATACATCATTCAATCTACAGTCTTGTCCCCGC

CATGGGATTCTGCTTTTGTTGTGGGGACAACTGCTTTTTTGAGCAGCCGGCAGTAATTTCATATTGACTGGGACCTGTATATTTACTCTGAGATTTTACC

ATTTGCATTTTTTGTTGTTTTGTTTTGTTTTGTTTTGAAACAAGGTCTCACATAGTGCACACTAGCCTTGCTCTCACAATATAACTGAGGTTGACTTCGA

ACTTGTAAGCCTTCTGCCTACACTTTGTGAGTGTTGGGCTTACAGGCATGTGCCACCACACATGGCTTTATGCAGTGATGGGGATCAAAGCCAGGGAAAG

ATGCGTGTGAGGGAAACCCGTTTACTAACTGAGCTACAGCCCTAGCCCCTTGCAAATATTTTTAGGAAGTAGAACCACATTGAGCTTTTTACAAAGCAGA

ATAAGAGGCTAGGGAGATGGCTAACTGGGTAAAGTGCTTATCGCACATACACACAAGAAGCTGAATTTGGATCTAGCACATAATAACAAGGCATAGTGGT

ACCTGCCTGTTCTTGTGCTGAGACGTGTATGCAGTGGGATCCTGAGGGCTTTCCTGGACAGTCAATTTAGCTAATAGTGGTTTAATGAGAGACCCTATCT

CAAAAAAAGTTGAAAAATGATAAGACACCTGATAGCGACATCTGTCCTCCACAAGTATAATCACACACACATACTACACACATGCAATGCAGACAAAGTT

ATAGAATGATTACAGGGTTGTTGGGCTTTCTAGAATTTGACACTTCTAGAATGTCCTTTCATGATGGGGTTATCTCTGGGGCTAGAGAGATGGCTCAGTG

TTCACAAGCATATAATGCTCTTGCAGAGGCCCTGAGTTTGATTGTTAGTATCCATGTCAAGTTGCTCATTACTGCCTATGACTCTAGTTCCAGGGTATCT

GATACCCTTGGCTGGTCTCCATGGACATGGTACTTATATTCACACACATGCAAATACACATAGTTTAAAAATAACTTTTAAAAAGCTTAAAGAGAAAATG

TGGTTATCTCTAGGGACAATAATGCCATTCATCTCTTACCTGTAGAAGGAGAATCAGTCATTAGAGATCCCCAAAAGGGTTAAAAACTCGGAAAGGAAGG

ACTGAATACTTAGATTGTCCTGTGTATTCTGGAGGAAGGAAGCACCAGTGGTCCTATAGTAATCCAGTATGTGTTATAATAAAGTGAATGTTGAAATTAA

CTGTATTCACTATCTCTAGTCCATGTTTTTTTCAATTCTGGAGTTGTCCTTGAGTACTTGTCTAACATTGTCTTTTGAATATTCTAATGGTCTGAATATA

TGGAAGTTATGTGTGTTGCCAGAATTACAAAATAATAATCAGGTC
Translation
 - UNI24272 - - UNI33169 - MHNPRLFLSRAGFFSKPGLLPWDTGRPPDLSQSLLGRAYKGSFTSVIAKKHPSRQKYQKKQRHCRDDSWQER 

- UNI24272 - - UNI27517 - RLADVVTPLWRLSYEAQLK PTTTGYRNKSTFSVYRSPDGNPKTVGYYLGTWKD DGNVVCLPCNHLKNIPEKH

SQVAQ YYEVFLRQSSVEPCLLFHEGGHWRELVVRTNRQGHTMAIVTFHPQGLSE EEVCVQKVTLKDFFTKGPGAICELTSLYFQES STMTRCSHQQS

PYQLLFGEPHIFEDLLGLKIRISPDAFFQINTAGAEMLYRIIGELSGVNSESLLLDICCGTG GVIGLSVAQRASQVHGIELVEQAVEDARWTAAFNG G

VTNCEFHAGRAETILPQLLKSQKDEKLTVAVVNPARAGLH HYRVVRAIRNCRTIHTLVFVSCKPHGESTRNFIE ELCCPPNSAKQLLGDPFVLREAVP

VDLFPHTPHCELVLLFTR
Transcript ENSMUST00000113252
Sequence
TCGCGCCATCCGCTGGTATTTTAGTTTGCCACTGCACGTCCGTCCAAGGCCTTAGTGACTCCCAAGGAGTCCCGG - UNI33169 - GACATCTGGCT

TGTTTCCAGCTTCTGGCTATTACAAATAAGGCTGCTATGAACACAGTGGAGCATGTGTCCTTGTG - UNI24272 - - UNI33169 - GCATCAAG

AGTCCTAAATGCACAACCCAAGACTATTCCTTTCCAGAGCGGGTTTCTTCTCCAAACCAGGACTGCTTCCCTGGGATACTGGAAGACCACCAGATTTGTC

ACAGTCCTTATTGGGCAGAGCATATAAAGGGAGTTTCACCAGCGTGATAGCTAAGAAGCACCCAAGCAGACAAAAATATCAGAAGAAACAAAGGCATTGT

AGAGATGACTCCTGGCAGGAGAG - UNI24272 - - UNI27517 - GCTGGCTGATGTTGTGACTCCACTCTGGAGGCTGAGTTATGAAGCACAAC

TCAAG GTGAAATTTGAAGCTCAGAAGAAACTTTTACAAAGCCTAGAGTCTCACCTAAAAGTGCTCCATGGAGTCAGTGACACAGTGGCTGCACATCAGT

CTGAGGGGCTCCGCTGTCTCCTCCATCCCATTATACCCTCT CCTACCACCACTGGCTACCGGAACAAGTCCACCTTTTCTGTGTACAGGAGCCCAGATG

GCAATCCAAAGACTGTGGGCTACTACCTAGGAACTTGGAAAG ATGGAAATGTCGTCTGTCTACCATGTAATCATCTGAAAAACATCCCAGAGAAACACA

GTCAAGTGGCTCAG TACTATGAAGTATTCCTTCGACAGTCTTCAGTGGAACCCTGCCTTCTCTTTCATGAAGGTGGACACTGGCGTGAACTCGTAGTTC

GTACCAATAGGCAAGGACACACAATGGCTATTGTCACTTTTCATCCCCAGGGATTAAGTGAG GAGGAGGTCTGTGTTCAGAAGGTGACCTTGAAGGATT

TTTTCACTAAAGGCCCTGGAGCGATCTGTGAATTGACCTCGCTCTATTTCCAGGAAAG CACCATGACCCGTTGCAGCCATCAGCAGTCCCCCTACCAGC

TCCTGTTTGGGGAGCCCCACATCTTTGAGGATCTTCTGGGTTTGAAGATTCGAATTTCTCCAGATGCCTTCTTCCAGATTAATACTGCTGGGGCAGAGAT

GCTGTATCGGATCATTGGGGAGCTGAGTGGAGTGAACTCTGAGAGCCTCCTCCTAGACATTTGCTGTGGCACGG GTGTGATTGGCCTCTCTGTGGCTCA

GCGTGCCTCCCAGGTTCATGGCATTGAGCTAGTGGAGCAGGCAGTAGAGGATGCCAGGTGGACTGCAGCCTTCAATG GTGTCACCAACTGTGAGTTTCA

CGCTGGCAGAGCAGAGACGATTTTGCCACAGCTGTTAAAGTCACAGAAAGATGAGAAGTTGACTGTTGCTGTGGTGAACCCTGCCCGAGCTGGATTGC A

TTACAGAGTGGTGCGAGCCATTCGGAACTGCAGGACCATCCACACTCTAGTGTTTGTTTCCTGCAAGCCCCATGGTGAAAGCACAAGGAACTTCATTGA 

ACTATGCTGTCCTCCAAATTCTGCAAAGCAGCTCCTAGGTGATCCATTCGTCCTGAGAGAAGCTGTACCTGTGGATTTGTTTCCCCACACCCCACACTGT

GAGCTGGTTCTCCTCTTCACTCGGTAAGACCTGGACGCTGCAGGCTGATAAGGCTGAAGTTTCCGAGACACCCAGGTTGCCATAGGAGACAGTGGAAGCA

TCACCAGAAAGACCAATTTTGAATCCTGGCCAAAAGAATTTGACTGGCCTCCTTCTCTGAGGCAGATTGGACTGTAGCTTGTCCTAGTCCTTTGGGGTTA

TCCATATTCCCTTAGCTTTGATTGCTCCTAACTCCTTGAACCTGAATTTGTGTTGCTCCATCCTTTTGCTGTCTATACATCATTCAATCTACAGTCTTGT

CCCCGCCATGGGATTCTGCTTTTGTTGTGGGGACAACTGCTTTTTTGAGCAGCCGGCAGTAATTTCATATTGACTGGGACCTGTATATTTACTCTGAGAT

TTTACCATTTGCATTTTTTGTTGTTTTGTTTTGTTTTGTTTTGAAACAAGGTCTCACATAGTGCACACTAGCCTTGCTCTCACAATATAACTGAGGTTGA

CTTCGAACTTGTAAGCCTTCTGCCTACACTTTGTGAGTGTTGGGCTTACAGGCATGTGCCACCACACATGGCTTTATGCAGTGATGGGGATCAAAGCCAG

GGAAAGATGCGTGTGAGGGAAACCCGTTTACTAACTGAGCTACAGCCCTAGCCCCTTGCAAATATTTTTAGGAAGTAGAACCACATTGAGCTTTTTACAA

AGCAGAATAAGAGGCTAGGGAGATGGCTAACTGGGTAAAGTGCTTATCGCACATACACACAAGAAGCTGAATTTGGATCTAGCACATAATAACAAGGCAT

AGTGGTACCTGCCTGTTCTTGTGCTGAGACGTGTATGCAGTGGGATCCTGAGGGCTTTCCTGGACAGTCAATTTAGCTAATAGTGGTTTAATGAGAGACC

CTATCTCAAAAAAAGTTGAAAAATGATAAGACACCTGATAGCGACATCTGTCCTCCACAAGTATAATCACACACACATACTACACACATGCAATGCAGAC

AAAGTTATAGAATGATTACAGGGTTGTTGGGCTTTCTAGAATTTGACACTTCTAGAATGTCCTTTCATGATGGGGTTATCTCTGGGGCTAGAGAGATGGC

TCAGTGTTCACAAGCATATAATGCTCTTGCAGAGGCCCTGAGTTTGATTGTTAGTATCCATGTCAAGTTGCTCATTACTGCCTATGACTCTAGTTCCAGG

GTATCTGATACCCTTGGCTGGTCTCCATGGACATGGTACTTATATTCACACACATGCAAATACACATAGTTTAAAAATAACTTTTAAAAAGCTTAAAGAG

AAAATGTGGTTATCTCTAGGGACAATAATGCCATTCATCTCTTACCTGTAGAAGGAGAATCAGTCATTAGAGATCCCCAAAAGGGTTAAAAACTCGGAAA

GGAAGGACTGAATACTTAGATTGTCCTGTGTATTCTGGAGGAAGGAAGCACCAGTGGTCCTATAGTAATCCAGTATGTGTTATAATAAAGTGAATGTTGA

AATTAA
Translation
 - UNI33169 -  - UNI24272 - - UNI33169 - MHNPRLFLSRAGFFSKPGLLPWDTGRPPDLSQSLLGRAYKGSFTSVIAKKHPSRQKYQK

KQRHCRDDSWQER - UNI24272 - - UNI27517 - RLADVVTPLWRLSYEAQLK VKFEAQKKLLQSLESHLKVLHGVSDTVAAHQSEGLRCLLH

PIIPS PTTTGYRNKSTFSVYRSPDGNPKTVGYYLGTWKD DGNVVCLPCNHLKNIPEKHSQVAQ YYEVFLRQSSVEPCLLFHEGGHWRELVVRTNRQG

HTMAIVTFHPQGLSE EEVCVQKVTLKDFFTKGPGAICELTSLYFQES STMTRCSHQQSPYQLLFGEPHIFEDLLGLKIRISPDAFFQINTAGAEMLYR

IIGELSGVNSESLLLDICCGTG GVIGLSVAQRASQVHGIELVEQAVEDARWTAAFNG GVTNCEFHAGRAETILPQLLKSQKDEKLTVAVVNPARAGLH

 HYRVVRAIRNCRTIHTLVFVSCKPHGESTRNFIE ELCCPPNSAKQLLGDPFVLREAVPVDLFPHTPHCELVLLFTR
Transcript ENSMUST00000087541
Sequence
GACTGGCCCCTGCAACCCCTTCGCGCCATCCGCTGGTATTTTAGTTTGCCACTGCACGTCCGTCCAAGGCCTTAGTGACTCCCAAGGAGTCCCGG - UN

I24272 - - UNI33169 - GCATCAAGAGTCCTAAATGCACAACCCAAGACTATTCCTTTCCAGAGCGGGTTTCTTCTCCAAACCAGGACTGCTTCC

CTGGGATACTGGAAGACCACCAGATTTGTCACAGTCCTTATTGGGCAGAGCATATAAAGGGAGTTTCACCAGCGTGATAGCTAAGAAGCACCCAAGCAGA

CAAAAATATCAGAAGAAACAAAGGCATTGTAGAGATGACTCCTGGCAGGAGAG - UNI24272 - - UNI27517 - GCTGGCTGATGTTGTGACTC

CACTCTGGAGGCTGAGTTATGAAGCACAACTCAAG GTGAAATTTGAAGCTCAGAAGAAACTTTTACAAAGCCTAGAGTCTCACCTAAAAGTGCTCCATG

GAGTCAGTGACACAGTGGCTGCACATCAGTCTGAGGGGCTCCGCTGTCTCCTCCATCCCATTATACCCTCT CCTACCACCACTGGCTACCGGAACAAGT

CCACCTTTTCTGTGTACAGGAGCCCAGATGGCAATCCAAAGACTGTGGGCTACTACCTAGGAACTTGGAAAG ATGGAAATGTCGTCTGTCTACCATGTA

ATCATCTGAAAAACATCCCAGAGAAACACAGTCAAGTGGCTCAG TACTATGAAGTATTCCTTCGACAGTCTTCAGTGGAACCCTGCCTTCTCTTTCATG

AAGGTGGACACTGGCGTGAACTCGTAGTTCGTACCAATAGGCAAGGACACACAATGGCTATTGTCACTTTTCATCCCCAGGGATTAAGTGAG GAGGAGG

TCTGTGTTCAGAAGGTGACCTTGAAGGATTTTTTCACTAAAGGCCCTGGAGCGATCTGTGAATTGACCTCGCTCTATTTCCAGGAAAG CACCATGACCC

GTTGCAGCCATCAGCAGTCCCCCTACCAGCTCCTGTTTGGGGAGCCCCACATCTTTGAGGATCTTCTGGGTTTGAAGATTCGAATTTCTCCAGATGCCTT

CTTCCAGATTAATACTGCTGGGGCAGAGATGCTGTATCGGATCATTGGGGAGCTGAGTGGAGTGAACTCTGAGAGCCTCCTCCTAGACATTTGCTGTGGC

ACGG GTGTGATTGGCCTCTCTGTGGCTCAGCGTGCCTCCCAGGTTCATGGCATTGAGCTAGTGGAGCAGGCAGTAGAGGATGCCAGGTGGACTGCAGCC

TTCAATG GTGTCACCAACTGTGAGTTTCACGCTGGCAGAGCAGAGACGATTTTGCCACAGCTGTTAAAGTCACAGAAAGATGAGAAGTTGACTGTTGCT

GTGGTGAACCCTGCCCGAGCTGGATTGC ATTACAGAGTGGTGCGAGCCATTCGGAACTGCAGGACCATCCACACTCTAGTGTTTGTTTCCTGCAAGCCC

CATGGTGAAAGCACAAGGAACTTCATTGA ACTATGCTGTCCTCCAAATTCTGCAAAGCAGCTCCTAGGTGATCCATTCGTCCTGAGAGAAGCTGTACCT

GTGGATTTGTTTCCCCACACCCCACACTGTGAGCTGGTTCTCCTCTTCACTCGGTAAGACCTGGACGCTGCAGGCTGATAAGGCTGAAGTTTCCGAGACA

CCCAGGTTGCCATAGGAGACAGTGGAAGCATCACCAGAAAGACCAATTTTGAATCCTGGCCAAAAGAATTTGACTGGCCTCCTTCTCTGAGGCAGATTGG

ACTGTAGCTTGTCCTAGTCCTTTGGGGTTATCCATATTCCCTTAGCTTTGATTGCTCCTAACTCCTTGAACCTGAATTTGTGTTGCTCCATCCTTTTGCT

GTCTATACATCATTCAATCTACAGTCTTGTCCCCGCCATGGGATTCTGCTTTTGTTGTGGGGACAACTGCTTTTTTGAGCAGCCGGCAGTAATTTCATAT

TGACTGGGACCTGTATATTTACTCTGAGATTTTACCATTTGCATTTTTTGTTGTTTTGTTTTGTTTTGTTTTGAAACAAGGTCTCACATAGTGCACACTA

GCCTTGCTCTCACAATATAACTGAGGTTGACTTCGAACTTGTAAGCCTTCTGCCTACACTTTGTGAGTGTTGGGCTTACAGGCATGTGCCACCACACATG

GCTTTATGCAGTGATGGGGATCAAAGCCAGGGAAAGATGCGTGTGAGGGAAACCCGTTTACTAACTGAGCTACAGCCCTAGCCCCTTGCAAATATTTTTA

GGAAGTAGAACCACATTGAGCTTTTTACAAAGCAGAATAAGAGGCTAGGGAGATGGCTAACTGGGTAAAGTGCTTATCGCACATACACACAAGAAGCTGA

ATTTGGATCTAGCACATAATAACAAGGCATAGTGGTACCTGCCTGTTCTTGTGCTGAGACGTGTATGCAGTGGGATCCTGAGGGCTTTCCTGGACAGTCA

ATTTAGCTAATAGTGGTTTAATGAGAGACCCTATCTCAAAAAAAGTTGAAAAATGATAAGACACCTGATAGCGACATCTGTCCTCCACAAGTATAATCAC

ACACACATACTACACACATGCAATGCAGACAAAGTTATAGAATGATTACAGGGTTGTTGGGCTTTCTAGAATTTGACACTTCTAGAATGTCCTTTCATGA

TGGGGTTATCTCTGGGGCTAGAGAGATGGCTCAGTGTTCACAAGCATATAATGCTCTTGCAGAGGCCCTGAGTTTGATTGTTAGTATCCATGTCAAGTTG

CTCATTACTGCCTATGACTCTAGTTCCAGGGTATCTGATACCCTTGGCTGGTCTCCATGGACATGGTACTTATATTCACACACATGCAAATACACATAGT

TTAAAAATAACTTTTAAAAAGCTTAAAGAGAAAATGTGGTTATCTCTAGGGACAATAATGCCATTCATCTCTTACCTGTAGAAGGAGAATCAGTCATTAG

AGATCCCCAAAAGGGTTAAAAACTCGGAAAGGAAGGACTGAATACTTAGATTGTCCTGTGTATTCTGGAGGAAGGAAGCACCAGTGGTCCTATAGTAATC

CAGTATGTGTTATAATAAAGTGAATGTTGAAATTAACTGTATTCACTATCTCTAGTCCATGTTTTTTTCAATTCTGGAGTTGTCCTTGAGTACTTGTCTA

ACATTGTCTTTTGAATATTCTAATGGTCTGAATATATGGAAGTTATGTGTGTTGCCAGAATTACAAAATAATAATCAGGTC
Translation
 - UNI24272 - - UNI33169 - MHNPRLFLSRAGFFSKPGLLPWDTGRPPDLSQSLLGRAYKGSFTSVIAKKHPSRQKYQKKQRHCRDDSWQER 

- UNI24272 - - UNI27517 - RLADVVTPLWRLSYEAQLK VKFEAQKKLLQSLESHLKVLHGVSDTVAAHQSEGLRCLLHPIIPS PTTTGYRN

KSTFSVYRSPDGNPKTVGYYLGTWKD DGNVVCLPCNHLKNIPEKHSQVAQ YYEVFLRQSSVEPCLLFHEGGHWRELVVRTNRQGHTMAIVTFHPQGLS

E EEVCVQKVTLKDFFTKGPGAICELTSLYFQES STMTRCSHQQSPYQLLFGEPHIFEDLLGLKIRISPDAFFQINTAGAEMLYRIIGELSGVNSESLL

LDICCGTG GVIGLSVAQRASQVHGIELVEQAVEDARWTAAFNG GVTNCEFHAGRAETILPQLLKSQKDEKLTVAVVNPARAGLH HYRVVRAIRNCRT

IHTLVFVSCKPHGESTRNFIE ELCCPPNSAKQLLGDPFVLREAVPVDLFPHTPHCELVLLFTR

For any suggestions or comments, please send an email to unitrap@crg.es