Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000067430 (1700065O13Rik)
Chromosomal location
Chr 17: 33153809 - 33170247 (-)
Description
RIKEN cDNA 1700065O13 gene Gene [Source:MGI Symbol;Acc:MGI:1920701]
RefSeq_dna
NM_028543 
RefSeq_peptide
NP_082819.1 
UniGene
Mm.129453 Mm.403626 
MGI
MGI:1920701 
Uniprot/SPTREMBL
Q7TNP7 Q8BIC7 Q9D9I0 
Human Ortholog
not available
Omim not available
UniTrap UNI27693
Vector Insertion
Chr 17: 33158650 - 33158778
Public Clones not available
Private Clones OST53151 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38409
Vector Insertion
Chr 17: 33158650 - 33170114
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114421
Sequence
GGGACACTGGAATTGTGCGCAGAGCAGGCGACCGGGCACCGGAGCCCGCTCTGTTCTGTCCTAGGGAAGCTACTTCGTTCCAGGCCCCTATCTTCATGGG

GTTAGTCCTCACCTGGAACCTGCGCCTCCGCAGACACTGCAGCACTGCAG - UNI27693 - GAGCCTGTGACCTTTGAGGATGTGGCTGTGAACTTC

AGTCCAGGAGAGTGGGCTCTGTTGGATTCCAGTCAAAAGAAGCTCTACAGAGATGTGATGACAGAAACCTTTATGAACCTGATCTCCATAG - UNI276

93 - TAAAAG GGAAAACAGAAGAAAACATTGAAGAGGACTATGCTAATGTCAGAA TAAATAA CAGAACTCAGATGATTGGGAGAAATTGTAAATAT

GAAGATAGCTTTCAGCGTGGAGAAGCCCACCACCGAATTCCAGAATATGTTGTTAACAAGGGCATGCCTTCTGCAACAGCAGTGTATGAAAGCAATGTGT

GGGCAAGAGGCATCCGTGCTCACTCCCCTTCACGTGTGCATCTCACAGATGAAACTGGAGCGAAACCATTTGAGAATAAGGAACATGTGCATGTAGCTTT

TCAGTATGAGACACGTTATGCAGATGTCACTTCTTCTGAGCCCTCTCACATACTAGAAGGTCCCAGAGAGATAGTTTATCAAAAGAAACAGCCTAATGAA

GCCTATAGGATTCTCACTTCTGATCAAAATTATGAGAGAATTGACAGTGAAGGTACATATAATCAGTTTGATAAAGCCATCCAGAGATATGCTTATTTTC

AGATGTATGAAAAACTCCACACTAGAGTGAAGCCATTTATGTGTAAGCAATGTGGGGAAGCCTTTGTTCATTTCAGCCAACTTGTCTACCATGAAAGAAT

TCATACAGGAGAGGAATGTTATGTGTGTAGTCAGTGTGGAAAAGCATTTAGACACTATTCATACCTCCAGAAACATGAAAGAATTCACAGTGGAGATACA

CCTTATGTGTGTAAGCAGTGTGGCAAAGCCTTTGTTCGTTCCTCACACCTTCTTGTCCATGAAAGGACTCACACTGGAGAGAAACCTTATACATGTAAGC

ATTGTGGGAAAGCCTTCAGTCATCACAGTGCCTGCTACAGACACGAAGTAATTCACACTGAAGAGAAACCCTATGTCTGTAAGCAGTGTGGGAAAGCATT

CACTTGTTCTACATCCCTTCGCAATCAC GAAAGGACTCACACTGGAGAGAAACCTTACACATGTAAGCATTGTGGGAAAGCCTTCACCCATTCCAGTAC

CCGGTATAGTCATGAAAGAATTCATACTGGAGAGAAACCATACGTATGTAAAAAGTGTGGCAAGGCATTCATTCATTCCAGTCATCTTATCAGCCATGAA

AAGATCCACACTGGAGAGAAACCGTATCCATGCAAGCATTGTGGGAAAGCCTTCATTCAACGGAAGGCGTGTCACAATCATGAAAGAACTCATACTGGAG

AGAAACCCTATGCATGTAAATATTGTGAAAAAGCATTTAGGTGTTCCACATACCTTCGGAACCATGAAAGAACTCACACTGGAGAGAAACCTTATATATG

TAAGCATTGTGGAAAAGCCTTTACACATCAGAGTGCCCGTTACCGTCATGAACGAATTCACACTGGAGAGAAACCCTACGTG
Translation
 - UNI27693 - EPVTFEDVAVNFSPGEWALLDSSQKKLYRDVMTETFMNLISIV - UNI27693 - VKG GKTEENIEEDYANVRI INN NRTQ

MIGRNCKYEDSFQRGEAHHRIPEYVVNKGMPSATAVYESNVWARGIRAHSPSRVHLTDETGAKPFENKEHVHVAFQYETRYADVTSSEPSHILEGPREIV

YQKKQPNEAYRILTSDQNYERIDSEGTYNQFDKAIQRYAYFQMYEKLHTRVKPFMCKQCGEAFVHFSQLVYHERIHTGEECYVCSQCGKAFRHYSYLQKH

ERIHSGDTPYVCKQCGKAFVRSSHLLVHERTHTGEKPYTCKHCGKAFSHHSACYRHEVIHTEEKPYVCKQCGKAFTCSTSLRNH ERTHTGEKPYTCKHC

GKAFTHSSTRYSHERIHTGEKPYVCKKCGKAFIHSSHLISHEKIHTGEKPYPCKHCGKAFIQRKACHNHERTHTGEKPYACKYCEKAFRCSTYLRNHERT

HTGEKPYICKHCGKAFTHQSARYRHERIHTGEKPYV
Transcript ENSMUST00000087654
Sequence
ATGCATATGAAAGAGGAAATG - UNI27693 - GAGCCTGTGACCTTTGAGGATGTGGCTGTGAACTTCAGTCCAGGAGAGTGGGCTCTGTTGGATTC

CAGTCAAAAGAAGCTCTACAGAGATGTGATGACAGAAACCTTTATGAACCTGATCTCCATAG - UNI27693 - GGAAAACAGAAGAAAACATTGAAG

AGGACTATGCTAATGTCAGAAGTCTGAG AACTCAGATGATTGGGAGAAATTGTAAATATGAAGATAGCTTTCAGCGTGGAGAAGCCCACCACCGAATTC

CAGAATATGTTGTTAACAAGGGCATGCCTTCTGCAACAGCAGTGTATGAAAGCAATGTGTGGGCAAGAGGCATCCGTGCTCACTCCCCTTCACGTGTGCA

TCTCACAGATGAAACTGGAGCGAAACCATTTGAGAATAAGGAACATGTGCATGTAGCTTTTCAGTATGAGACACGTTATGCAGATGTCACTTCTTCTGAG

CCCTCTCACATACTAGAAGGTCCCAGAGAGATAGTTTATCAAAAGAAACAGCCTAATGAAGCCTATAGGATTCTCACTTCTGATCAAAATTATGAGAGAA

TTGACAGTGAAGGTACATATAATCAGTTTGATAAAGCCATCCAGAGATATGCTTATTTTCAGATGTATGAAAAACTCCACACTAGAGTGAAGCCATTTAT

GTGTAAGCAATGTGGGGAAGCCTTTGTTCATTTCAGCCAACTTGTCTACCATGAAAGAATTCATACAGGAGAGGAATGTTATGTGTGTAGTCAGTGTGGA

AAAGCATTTAGACACTATTCATACCTCCAGAAACATGAAAGAATTCACAGTGGAGATACACCTTATGTGTGTAAGCAGTGTGGCAAAGCCTTTGTTCGTT

CCTCACACCTTCTTGTCCATGAAAGGACTCACACTGGAGAGAAACCTTATACATGTAAGCATTGTGGGAAAGCCTTCAGTCATCACAGTGCCTGCTACAG

ACACGAAGTAATTCACACTGAAGAGAAACCCTATGTCTGTAAGCAGTGTGGGAAAGCATTCACTTGTTCTACATCCCTTCGCAATCACGGAAGAATTCAC

ACTGGAGAAAAACCTTACGCATGTAAGCAGTGTGGCAAATCCTTCATCCAACGAGATGCTTGCTACAATCACGAAAGAACTCATACTGGAGAGAAGCCCT

ATGTGTGTAAGCAGTGTGGGAAAGCATTTACATGGTCCACATGCCTTCGCAACCATGAAAGGACTCACACTGGAGAGAAACCTTACACATGTAAGCATTG

TGGGAAAGCCTTCACCCATTCCAGTACCCGGTATAGTCATGAAAGAATTCATACTGGAGAGAAACCATACGTATGTAAAAAGTGTGGCAAGGCATTCATT

CATTCCAGTCATCTTATCAGCCATGAAAAGATCCACACTGGAGAGAAACCGTATCCATGCAAGCATTGTGGGAAAGCCTTCATTCAACGGAAGGCGTGTC

ACAATCATGAAAGAACTCATACTGGAGAGAAACCCTATGCATGTAAATATTGTGAAAAAGCATTTAGGTGTTCCACATACCTTCGGAACCATGAAAGAAC

TCACACTGGAGAGAAACCTTATATATGTAAGCATTGTGGAAAAGCCTTTACACATCAGAGTGCCCGTTACCGTCATGAACGAATTCACACTGGAGAGAAA

CCCTACGTGTGTAAAAAATGTGGGAAAGCATTCAGTGATTGTAGCTACCTTGTGAAGCATGAAAGAATCCATTGGAGAGAAACTTTACACATGTAAGAAT

CAAGAAGCTTTTATGTGTTCCACATTCCTTTATACACACAAAAGAGCTGACAGAGAAGAGCTGAGAACTTTACAGCAGTGTATCTGGTGGACTTGTCTGT

GCACAACTTATATGCATGAAAAAAATGTGAGAACAGCTCACAAAGAGGCTCGGCGGGTAAAGGTGCTTGTTACTAAGCTTGAGAATCTGAGTTCCGTCCC

AGGGACCCATATGGTAGAAATAGAAAATTAATCCCCCAAATTTACCTCTGAATTCCATGTATACATGTGGACCCCCACACAACCCCATTATTTAAAGTGT

ATATACATATAGAGAACAATTGAAATTTTCAGAAGTTAGTTGTATCCCTGATATGCAAGCATATATAGGATAAAATCCTATGGCACTGGGCATGGTAGGA

TGTGCCTTTTATTCTAGCACTGGGCAAGGTGGGGATAGTAAAGAGTAGAGAGTTATAATGGATATAGTGGATTTGAACACTCCATGGGAAGTTTAGGATG

AGCTAGTTACAAGCAAGCAGAATTTTCTTTGCAAGAAGAAAAAACTAGAGAGACAGTTCAGCTGTTCAGAGCCCATGCTGCTCTGCCAGGGGGCCTGAGT

TTGTCTCAGCATCAACATTGTGTGGCTTACAACCATCTAAGAACTGTGATGCCCTCTTCTGGCCTCTGTAGGGATAGAACACATGGGATGCATATACATA

TAAATAAAATAAGTCTTTTTTTTTAAAAATTATGTGTACAAAGCAAATAGGAGAAACGTGTTTTTTCAAAAAATCTGAAGTATCATGTAGTCTAATCTTA

TAAGAATAAGAAATGTGGAGACAGCAAATTTATTTGCACAGGATATTTCTGGGGATAACCTGGAGTACAGTAAAATTATGAGCATTTTTTCATTGTCTGA

TTCTTACATGAGATCTTTAGTTTGCATTATTTTTTTTTTTTTATATTTCTGATAGAAGATTTGGTGAATAATGTCATGATTTTGCCTGCCTATATTTCCT

GGTTCTTGAACTGCTGAATCTAACACGACACTGTCTCTAGCAATACAATCACATCCATATAAAGAAACATTTGCATTGAGGTGATGTAAGCGTGATTAAT

TAATTTCAGTTCAGTGGGTGTTGTTTAATGAAGTGAGGCAGTGCTTTTTCTACTTTACTGTAGAGCTGTTGGAGTCACTGAACTGAGATACATTTGTAAT

AAAACAGTAGACTTAATTTTATCTAGTTTGTTGGTAAATGTGGTTCATTTGAAAGTGAAACTGTAAGCTGCTTAAAAGTGCTTTCTCACTCTTACATGTC

ATTTTTTAAAAATATTAACCCCTTTGCAATTTCCTTGCATTTATGTGAAAAATGGAATGTTTCTGGCATTTGTATAGATTTTATATTTTGTGCTTTTTAG

TGTATGTGTTCTAATAAGTGTTTTGTTTCTTTTTTTGTTTGTAGATAGGATCTTACTATGTATGCTTGGCTGGCCTAGAGCTTACATAGTTCCTGCCTTT

GCCTCCAAAGAGTTGGAATTAAAACTTACACTACC
Translation
MHMKEEM - UNI27693 - EPVTFEDVAVNFSPGEWALLDSSQKKLYRDVMTETFMNLISIG - UNI27693 - GKTEENIEEDYANVRSLR RTQ

MIGRNCKYEDSFQRGEAHHRIPEYVVNKGMPSATAVYESNVWARGIRAHSPSRVHLTDETGAKPFENKEHVHVAFQYETRYADVTSSEPSHILEGPREIV

YQKKQPNEAYRILTSDQNYERIDSEGTYNQFDKAIQRYAYFQMYEKLHTRVKPFMCKQCGEAFVHFSQLVYHERIHTGEECYVCSQCGKAFRHYSYLQKH

ERIHSGDTPYVCKQCGKAFVRSSHLLVHERTHTGEKPYTCKHCGKAFSHHSACYRHEVIHTEEKPYVCKQCGKAFTCSTSLRNHGRIHTGEKPYACKQCG

KSFIQRDACYNHERTHTGEKPYVCKQCGKAFTWSTCLRNHERTHTGEKPYTCKHCGKAFTHSSTRYSHERIHTGEKPYVCKKCGKAFIHSSHLISHEKIH

TGEKPYPCKHCGKAFIQRKACHNHERTHTGEKPYACKYCEKAFRCSTYLRNHERTHTGEKPYICKHCGKAFTHQSARYRHERIHTGEKPYVCKKCGKAFS

DCSYLVKHERIHWRETLHM
Transcript ENSMUST00000087658
Sequence
GGGACACTGGAATTGTGCGCAGAGCAGGCGACCGGGCACCGGAGCCCGCTCTGTTCTGTCCTAGGGAAGCTACTTCGTTCCAGGCCCCTATCTTCATGGG

GTTAGTCCTCACCTGGAACCTGCGCCTCCGCAGACACTGCAGCACTGCAG - UNI27693 - GAGCCTGTGACCTTTGAGGATGTGGCTGTGAACTTC

AGTCCAGGAGAGTGGGCTCTGTTGGATTCCAGTCAAAAGAAGCTCTACAGAGATGTGATGACAGAAACCTTTATGAACCTGATCTCCATAG - UNI276

93 - GGAAAACAGAAGAAAACATTGAAGAGGACTATGCTAATGTCAGAAGTCTGAG AACTCAGATGATTGGGAGAAATTGTAAATATGAAGATAGCTT

TCAGCGTGGAGAAGCCCACCACCGAATTCCAGAATATGTTGTTAACAAGGGCATGCCTTCTGCAACAGCAGTGTATGAAAGCAATGTGTGGGCAAGAGGC

ATCCGTGCTCACTCCCCTTCACGTGTGCATCTCACAGATGAAACTGGAGCGAAACCATTTGAGAATAAG ATAGGATCTTACTATGTATGCTTGGCTGGC

CTAGAGCTTACATAGTTCCTGCCTTTGCCTCCAAAGAGTTGGAATTAAAACTTACACTACC
Translation
 - UNI27693 - MTETFMNLISIG - UNI27693 - GKTEENIEEDYANVRSLR RTQMIGRNCKYEDSFQRGEAHHRIPEYVVNKGMPSATAVYE

SNVWARGIRAHSPSRVHLTDETGAKPFENK IGSYYVCLAGLELT

For any suggestions or comments, please send an email to unitrap@crg.es