Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000067567 (Hdac8)
Chromosomal location
Chr X: 99479978 - 99700698 (-)
Description
histone deacetylase 8 Gene [Source:MGI (curated);Acc:Hdac8-001]
RefSeq_dna
NM_027382 
RefSeq_peptide
NP_081658.1 
UniGene
Mm.328128 
MGI
MGI:1917565 
Uniprot/SWISSPROT
Q8VH37 
Uniprot/SPTREMBL
A2AWU6 
Human Ortholog
ENSG00000147099 (HDAC8)
Omim not available
UniTrap UNI14070
Vector Insertion
Chr X: 99480508 - 99502977
Public Clones CMHD-GT_140A11-3 (cmhd) CMHD-GT_415H4-3 (cmhd) CMHD-GT_107E11-3 (cmhd) CMHD-GT_478B1-3 (cmhd)
PSTVUpb17b9 (vanderbilt)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113616
Sequence
GTGCTACTTGTGCCATGAAAAAATTGATCCCAATTGGCAGTTATTTGGTTTTTATATCTGTCAGGCACCTTTTTTGAACTGTGGTCATCAGTAGAAGGCA

TCTGGTCTGGAAGGGCCCATCCATCCCTGTAGTTGGACGAGGGACCAGGGAAACTGTCTCCGGCGATCTAAATAGGAGGGAATGTTGACAAGGGAGCACC

GCTGGGGCTGAACAGAGGAGCAGGAACTGGAGCTCAGGCTGAGTCTGAAAACTGTTGGCTCCAGACTTTGGCTCGCGGACGGTTGGAAGTGGGAGATGGA

GATGCCAGAGGAACCCGCCAACAGTGGGCATTCACTACCCCCGGTTTATATTTACAGTCCCGAGTATGTCAGCATCTGCGACTCCCTTGTGAAGGTCCCC

AAACGG GCCAGTATGGTCCACTCTCTGATCGAAGCCTATGCCCTGCATAAACAAATGAG GATAGTGAAGCCCAAAGTGGCCTCCATGGAGGAGATGGC

CACCTTCCACACTGATGCCTATCTGCAACATCTCCAGAAAGTCAGCCAAGAAGGTGATGAGGACCATCCAGACTCCATAGAATATGGACTAG GTTATGA

CTGCCCAGCCACAGAAGGGATATTTGACTATGCAGCAGCTATAGGAGGAGGTACAATCACAGCTGCCCAGTGCCTGATTGACGGGAAGTGTAAAGTAGCC

ATCAACTGGTCTGGAGGGTGGCATCATGCAAAGAA AGATGAAGCATCTGGTTTCTGTTATCTCAATGATGCTGTCCTGGGAATATTACGATTGCGACGG

AAATTTGACCGTATTCTCTACGTGGATTTGGATCTACACCATGGAGATG GTGTAGAAGATGCCTTCAGTTTTACATCGAAGGTTATGACTGTGTCCCTG

CACAAGTTCTCCCCAGGATTTTTCCCAG GAACAGGTGACATGTCTGATGTTGGCCTGGGGAAAGGACGGTACTACAGTGTCAATGTGCCCATTCAGGAT

GGCATCCAGGATGAGAAGTACTATCACATCTGTGAAAG AGCCTGTTTCACCAGAACTCCCTGA
Translation
MEMPEEPANSGHSLPPVYIYSPEYVSICDSLVKVPKR ASMVHSLIEAYALHKQMR RIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDEDHPDSIEYG

LG GYDCPATEGIFDYAAAIGGGTITAAQCLIDGKCKVAINWSGGWHHAKK KDEASGFCYLNDAVLGILRLRRKFDRILYVDLDLHHGDG GVEDAFSF

TSKVMTVSLHKFSPGFFPG GTGDMSDVGLGKGRYYSVNVPIQDGIQDEKYYHICER RACFTRTP
Transcript ENSMUST00000087916
Sequence
GTGCTACTTGTGCCATGAAAAAATTGATCCCAATTGGCAGTTATTTGGTTTTTATATCTGTCAGGCACCTTTTTTGAACTGTGGTCATCAGTAGAAGGCA

TCTGGTCTGGAAGGGCCCATCCATCCCTGTAGTTGGACGAGGGACCAGGGAAACTGTCTCCGGCGATCTAAATAGGAGGGAATGTTGACAAGGGAGCACC

GCTGGGGCTGAACAGAGGAGCAGGAACTGGAGCTCAGGCTGAGTCTGAAAACTGTTGGCTCCAGACTTTGGCTCGCGGACGGTTGGAAGTGGGAGATGGA

GATGCCAGAGGAACCCGCCAACAGTGGGCATTCACTACCCCCGGTTTATATTTACAGTCCCGAGTATGTCAGCATCTGCGACTCCCTTGTGAAGGTCCCC

AAACGG GCCAGTATGGTCCACTCTCTGATCGAAGCCTATGCCCTGCATAAACAAATGAG GATAGTGAAGCCCAAAGTGGCCTCCATGGAGGAGATGGC

CACCTTCCACACTGATGCCTATCTGCAACATCTCCAGAAAGTCAGCCAAGAAGGTGATGAGGACCATCCAGACTCCATAGAATATGGACTAG GTTATGA

CTGCCCAGCCACAGAAGGGATATTTGACTATGCAGCAGCTATAGGAGGAGGTACAATCACAGCTGCCCAGTGCCTGATTGACGGGAAGTGTAAAGTAGCC

ATCAACTGGTCTGGAGGGTGGCATCATGCAAAGAA AGATGAAGCATCTGGTTTCTGTTATCTCAATGATGCTGTCCTGGGAATATTACGATTGCGACGG

AAATTTGACCGTATTCTCTACGTGGATTTGGATCTACACCATGGAGATG GTGTAGAAGATGCCTTCAGTTTTACATCGAAGGTTATGACTGTGTCCCTG

CACAAGTTCTCCCCAGGATTTTTCCCAG GAACAGGTGACATGTCTGATGTTGGCCTGGGGAAAGGACGGTACTACAGTGTCAATGTGCCCATTCAGGAT

GGCATCCAGGATGAGAAGTACTATCACATCTGTGAAAG TGTACTAAAAGAAGTGTACCAGGCCTTCAATCCGAAGGCAGTGGTTTTACAGCTGGGAGCA

GATACTATTGCCGGAGATCCAATGTGTTCCTTTAATATGACACCAGTGGGGATCGGCAAGTGTCTGAAGTATGTCCTACAGTGGCAGCTGGCAACTCTGA

TTTTAGGAGGAG GAGGCTATAACCTTGCCAACACGGCTCGTTGCTGGACATACTTGACCGGGGTCATCCTAGGGAAAACGCTATCCTCTGAGATCCCAG

ATCATGAG TTTTTCACAGCATATGGTCCTGATTATGTGCTGGAAATCACGCCAAGCTGCCGGCCAGACCGCAATGAGCCCCACCGAATCCAGCAAATCC

TCAACTACATCAAAG - UNI14070 - GGAATCTGAAGCATGTGGTCTAGTTGACAAAAAGAGATCAGGTTCCCAGAGCTGGGCAGCAGTGCCTATAA

TGAAGACAGTGTGTTGATGCAAGCGGTTTGTGGAATTTGTGACTGCAGGGGAAATTTGGAAGAAATTACTTCCTGAAAATTTCCAAGGGGCACCAAGTGG

CAGCTGGCCTCCTGGGGTGAGGAGCCAGGCACCCCGGAGCCAGGCCTAAGGGGAAGAAGAAGATAGCCAGTGTTTAAAGTGTTTATTTTAAAACACAAAT

GCAGTTTTTAATGGTTCAAAATTATTTTTAAGCAAGTTGGGGGGAAGAATTTTATCTTCATAAAGGGGACAAGTCAGGAGCTGCAGAAGAGTGGGGTTGG

GTAGGGGGGTCAGCAGATGGGCAGGTTCGGCCCTCGGGGCCATTTAGATAGAGACCTGTGGGGGAGGGGTATCAGCAGACTGGGAGGTAAGGAGGAGTCT

ACCACTTTTGTTTTAGTATGATGCACTCCAGTTGTTCTTAATAAAAGTTTTGAAAATGT
Translation
MEMPEEPANSGHSLPPVYIYSPEYVSICDSLVKVPKR ASMVHSLIEAYALHKQMR RIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDEDHPDSIEYG

LG GYDCPATEGIFDYAAAIGGGTITAAQCLIDGKCKVAINWSGGWHHAKK KDEASGFCYLNDAVLGILRLRRKFDRILYVDLDLHHGDG GVEDAFSF

TSKVMTVSLHKFSPGFFPG GTGDMSDVGLGKGRYYSVNVPIQDGIQDEKYYHICES SVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKC

LKYVLQWQLATLILGGG GGYNLANTARCWTYLTGVILGKTLSSEIPDHE FFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKG - UNI14070 -

 GNLKHVV

For any suggestions or comments, please send an email to unitrap@crg.es