Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000067577 (A430093F15Rik)
Chromosomal location
Chr 19: 10815437 - 10860533 (+)
Description
RIKEN cDNA A430093F15 gene Gene [Source:MGI Symbol;Acc:MGI:2685520]
UniGene
Mm.34482 
MGI
MGI:2685520 
Uniprot/SPTREMBL
Q8C505 
Human Ortholog
not available
Omim not available
UniTrap UNI31444
Vector Insertion
Chr 19: 10815493 - 10856251
Public Clones IST12551D4 (tigm) IST12628B6 (tigm) IST11484G11 (tigm) IST14998H11 (tigm)
IST13149E1 (tigm) IST10668H3 (tigm) IST11343C2 (tigm) IST13149F3 (tigm)
IST12400A3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37292
Vector Insertion
Chr 19: 10859836 - 10859907
Public Clones CMHD-GT_449A2-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000087947
Sequence
AGAACCTCAACAGCCTCCGAGGGACAGGCTCTGCCCTATTGCCTTGGCGACACCAG - UNI31444 - TCTTGAAAATATGACATTGGACACGAAGTA

TGAATCACATCCTGCCTCAGTGAGCTTTTGACAAGATGTTACAGAAAACAGCTCTACAATGTGGGGGCCTGTGTGCAACTTACTGTCAGTCAGTGCTGGA

GACCAGGGGCATGGGGCCTCCAGAAGCACCTTCCACCTTCCACACAGCGCGAAAAGAAGACACACTGATGATGGTCAGGCCCCAGTGACTCAGAATTCAT

TTTTTCTTTTTTTAGTTTTTAGTTTTTTAGATAAATTGGGTAGGCACAAGTGTTAGTGCATGGAGCTCGGACATGGCTTTTTATGGTAGAGCTGCAGAGT

TTGATAGCTACAGTGACTGTAGCTATCAAATCCTAAGGTATTTTTTAGTCCCCTTGCCTGGCTCCTGACCAATAGCCAAACCCGCAAAAGTGCATTGTTT

GGATAACATAGTCTCTGTGCTGTGATTCAGCTAAGAGTTTAAGAACTCTAAGAAAGCAGTTTGTGTTCAGGTATGCGTGACCAGCATCTCCCAGGAGAAG

CCATCTTTTAAACCAACTCTAGAGAAGGCAGGCCTCTTACTGAAGACGGAGCAGGGACTAATGGCCCCTCAGTAGGCATTGGCGTTGGCTGTGGACATTT

TGGGAAGGAGCTCTTCCAGAGCCTTCAGTTTCAGCGTTTGTAGCCGACAGATGAAAGTTTGTATGAGTCCATGTGTTCACTTACAAACACCCTGAGGTGT

CCCTGGATGCCTTCCGTGGCCCCTTCTCAGGTTACAAACTTCCTGGACCTGTAGCAGCCTCAAGGAAGCCAGACACAGCAAACTGGAAGGGTGCTATACC

CTGCCAGCCCCACCCTGGTACAAGACTTGAGGACTGGCACATATGTCTGTCACCCACTCCGTGGTCAACCAGGGCAACTTAGTGAGACTCTTGACTCCAA

AAACATAAAATTTTTAAAATGAAGGAAAGGTTGAACTTATAGCTCAGTGGCAGGGCGCTTCCCGGATGTGTGTGGGTCATGGGTTCACCCTCAGCATTGC

CAGACAAATGCTCATCTAGAGATTGACTGGCCTCTGGATTGCCAGTTGGAGGCCTTAAAGAGGGGAAAGTCTATACTGTGGACTCATGTCTCAGCTATGG

CCAGTGAGACTCTCTCAGCATCAGTGACTTCGTCTCCAAAGCTGGGCAAAGTCCTGGAATTTGCCAGCAATCCTTGGGCCTCAGCCGCTCCTCTAGAGAG

AGGAGAGGGTGATGTGTTGCAAAGCCTCTCCTTAGGACACTGCATCTCTGCTGGCTGAGCCTCTTGGTAATGGTTTCTGCTGATGCTGAG GGAAATATG

GCCCGAGGCAGATGGCGAGAAAGCTGCGCTGGCGGCCAGAAGGGATCGGAGCCAGCTGGAGCCACGAGTCAGGGCAGACTCTCAAAGCTCAGTTTCCTTG

GATG CTCTCCATCTAGCCCTGAGGCCGACACCCTAAACTTCTGGGACCCCAGGAATGTGGGATTCAGAGAGGCCAGTTCGGCTGGAGACAGTTCCACAC

CAAGGATGCTTTTCCCAAGGACACAGTCCCTATCTTCTAGGTGCCTGGACTCCACACGTGCCGAGTGCTCCTGAAATGAAGTTCTAGAACCTACAGCCAC

TGGACAGGTCTCTAGTGGAAAAGCAATGCCTGTGAGTTTGCTTGGGCTGGCCTTGAACTCACTATATAGTTAAGTATGATCATGAACCTCTCATCCTCCT

GCCTCAGGCTCCTGAGTGTTGGGATAACTGGTGTGTTTCCTAAAAGCAAGACTATTTCTTTACAGACTCCGGCATACGTTCAGAGCATGAAACTTGACCC

TGATTGCATCCTGTTACTTGACTTGTAAACCTCACTCTGTTTGTGCCTGCCCATCAATGCCTTCTTAGTAAAGGAAAACCCTAGCACCATGGCTGCCTCT

CTCAGGCCCCTCTGAGAGGAGGCTGCCCCTGAGTCTTTGTATTTTGTCTTTCAAGAAACACATGTTGGATGCTTTGTAAAATGTCAAAGATCCCATTGAA

AATAAATTTATTTTTATTTTATTTTCTACAC
Translation
 - UNI31444 - MVSADAE GNMARGRWRESCAGGQKGSEPAGATSQGRLSKLSFLGC CSPSSPEADTLNFWDPRNVGFREASSAGDSSTPRMLFPR

TQSLSSRCLDSTRAECS

For any suggestions or comments, please send an email to unitrap@crg.es