Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000067928 (Zfp760)
Chromosomal location
Chr 17: 21844702 - 21862596 (+)
Description
zinc finger protein 760 Gene [Source:MGI Symbol;Acc:MGI:2679257]
RefSeq_dna
NM_001008501 
RefSeq_peptide
NP_001008501.1 
UniGene
Mm.393556 Mm.34723 
MGI
MGI:2679257 
Uniprot/SPTREMBL
Q05C60 Q5U4A6 
Human Ortholog
ENSG00000198633 (AC010320.10)
Omim not available
UniTrap UNI22720
Vector Insertion
Chr 17: 21844861 - 21845577
Public Clones (sanger)
Private Clones OST286671 (lexicon) OST149091 (lexicon) OST126435 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10435
Vector Insertion
Chr 17: 21845690 - 21846171
Public Clones D063F11 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24917
Vector Insertion
Chr 17: 21846187 - 21846264
Public Clones not available
Private Clones OST201076 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23281
Vector Insertion
Chr 17: 21846264 - 21856013
Public Clones not available
Private Clones OST267374 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115541
Sequence
GCCGACACTGGCCAGAGTTTCAAGTAGATGTGAAAACTTCCTGCAGCCACTGGAGCCTCGTAGAACGGTCTGGGAGACTCGCCGGTCCGCACCACAGTGG

CGGGAACCGCAGCCCGGCGATCCTAGCATCTCCCAGGTCAGAAGAGCTGTAGTAAACAG - UNI22720 - GGTTGTTGACATGCGGTGAACTTCTCT

CAGGAAGAAGAGGAAATGCCTGGACCTCACTCATAGGGTTTTGTACTGAGATTGAATATTGCAGAATTGCAGCAGTCCTGTTTCT - UNI10435 - -

 UNI24917 - CTACACCTGCTTATCGTCGAGCAGGACAAAGTGCCCTGGAAGGTGGAGAGAGAGGCATCAGTAGCAAAGGATCCAG - UNI23281 

- - UNI24917 - GCAAGAAGGGGTCCAGCCATTGTTCTTGAGACAGAAACTCAGAGCAGATCAACAGGAAGAAATGGCTGCTTCTCCA GGTCTGTT

GACATTCGGGGATGTGGCTTTGGACTTCTCCCAGGAGGAGTGGGAATGCCTGGACTCTGCTCAGAGGGCTCTGTACATTGATGTGATGTTGGAAAATTAC

ATCAACTTGGTCTCTGTTG ACTTGTACAGCAAAGAACTCATAGTGGAGAGAAAGCACACAATTGTGGGAAATGCTTTAGGAGTTGCTCAAGCCTCAGTA

CACATCAGAGACTTCACACTGGAGAGAAACCATGGAAATGTAAAGAATGTG CTCTTAAAAGACATCAGAAAATTCATACTGATGAAAAACCCTACAAAT

GTGAAGAGTGCAGCAAATGTTTTTATGTGTTGTCTCACCTAAAAAGCCATTGCAGAACCCATACTGGAGAGAAGCCTTACAAATGTGAGGAATGTGGTAA

GTGCCTTTCTCAGTTGTCAAAACTTAAAAGCCATTATAGAATCCATACAGGAGAGAAACCTTATAAGTGTAAGGAATGCGACAAATCCTTTACCCATTGC

ACAGCTCTTAGTACACATCAGAAAATTCATACTGGAGAGAAACCCTACTCATGCAAAGACTGTGGTAAATCCTTTTATCTGTTATCAAGACTTAAAGAAC

ATTACAGAGTCCACACTGGAGAGAAACCGTACAATTGTAAGGAATGTGGTAAGTTCTTCCATTGGTTGTCAAACCTTAAAAGACATTCCAGAATTCACAC

TGGAGAGAAACCTTACAAATGTGAGGAATGTGACAAATCCTTTACCCACTGCTCAAGTCTTAAAGCTCATCAGAAAATTCATGCTGGGGTAAAACCCTAC

AAATGTGAAGAATGTAGCAAGTCCTTTTATTGGTTGTCAAACCTTAAAACCCATTCCAGAATCCACACTGGAGAAAAACCTTACAAATGTGGTAAATGTG

ACAAATCCTTTACCCAGCGCTCTCTTCTTACAAAGCACAACAGGATCCATACTAGAGAAAAACATGAAAACAGGAAATATGTGAGAACTTTTGATGAATG

ATTAAATCATAGAAAATTCCAAGAGTTTATAACTAATTCATGAGGACAAAATGTAGTCAGAAATTCAAACCAGAACTAAACCAGAAGAATGTTCACTGTC

GTAAAATCCTCATATCTTATGCATTAGAAATTCCATGCTAGAAAACCCATGATATGCATTGATTTTTTTTTTCAGTTTTTACCTAGTGCTAAAATTGTAG

ATACATCTGAAAATTCATCCTGAAGGGAAACGCAAGAATCTCCTTTAATAATGAGTCCTCTTTTTTTTTTTTTTTAACCTTCAAAATAATCATTCAGGAG

TCAAATTGTACAGACAGCGTGAGTATGAGAAATGTTAAAGAGATAACTTGTGGATGTGATACATGTACATGCATAGCCTGGAAGTCCCAAAGAATGTGCA

GGAAAATTGGTTTTCCTGTACTCAAGAAAATTGGAAAAGTATTTAGTCCAACTGAAAAACACAATGATTCATATAGAAACACTAAGACACAGACATTAGA

TAAACAAGTGTATTGCAAAGAAGGAAACCAAATGCGTAAAGGAATTTGTTATGTACTTGAGTGGAGGAGGATATTTCTATTTGAGTAAATATATAATTCA

TATTAACATTTGGGTAATGCTAGTATTGGAATTTGATGAAATGTAAACACAATAGTTTTTTTTTTTTATACTCAGATGCATCTATGCTGTCTTGCTTACA

GATGATTTTATGATAATGTGTATCTATTGTTGCTGCTTCAGTGCTGATGAATCTGAGTCAGGAGTGGTGAAGTTAGGTAGCTAATGACTGCTAACCATCT

GGTGAGTCCAACTATCTAGACCGACTCATGATGGCAAATTTAGAGTCTCCCTGGGTCACGTCTTCATGCAGATGCTGCACAGACCAAGGCCTCTCTGCTT

GATGACCTTTTGAAAACTATACTAGTTCATGGCAGTGTTACAGTCCCAGAGAGAATTCTGTCATTGTGTGCCTGTGAAGACCACTTTAAAAAAAAAACAA

AAAACAAAAAACAAACAAACACTTATCTCCGATTATTTTCTTCATTGGTTCACTATGTAAAAAGCCATGGTAACCTGAGCAGAATCCTGTCTTGGAATCC

CTTTGGTTTCAGGAGTTATTCTTCGCCTTTATTTGTTGTTACATGGTGGTTGAAGTGCCCTACTCTGTTGGAGTTCACTTTTCTTTGTGTGAGCAGGATT

CTGAGATCATGGTACCTTACAGGCAATGTAGCTTGCTGCCTGTTGCTCCTAACAATCTACTCTCTGTTAATAACGTGTCGTTAATATCACTTGGTCCATG

AAAAATTAGTAGTCTAAGCAAGCTTCAATACTGTAACACAAATGGAGATGAGTTTTATTTTGCAGGAGGAACACGTGTATGATGTATGAGCAATAGGAAG

GGAAAAGGGCTATCCAAGTCTTCAATAGGCAGACACAGGGGGATCTCAATAATATATTTTAGAAATATCTGAAAAATGATAAGTCCATAGAATTGCTGAT

CTCTATCTCGATATCCTCGATGAAATTTATGTAAAAAAATAGTTATCAAAGGACAGTCAAATCTAATATTTGAGAATATATAGTTGTATTGAACAATGTG

TACCATGAAACTCACACCTTGGCTTTCTTTGAAAATGGTCAATAGTAACTGTAGGTTTCCATATTTTAGTAAAGTAACATCCCTCTTATTGTTATCTATA

CTTTTTGTAAAACCACATTTATTTTTAAATGTTCTACAACTCTATGTAAGGTGATTTTTTTAAATAAATAAAACATCTGTGTTT
Translation
 - UNI22720 -  - UNI10435 - - UNI24917 -  - UNI23281 - - UNI24917 - MAASP GLLTFGDVALDFSQEEWECLDSAQRA

LYIDVMLENYINLVSVD DLYSKELIVERKHTIVGNALGVAQASVHIRDFTLERNHGNVKNV LLKDIRKFILMKNPTNVKSAANVFMCCLT
Transcript ENSMUST00000073312
Sequence
ACTGGCCAGAGTTTCAAGTAGATGTGAAAACTTCCTGCAGCCACTGGAGCCTCGTAGAACGGTCTGGGAGACTCGCCGGTCCGCACCACAGTGGCGGGAA

CCGCAGCCCGGCGATCCTAGCATCTCCCAGGTCAGAAGAGCTGTAGTAAACAG - UNI22720 - GGTTGTTGACATGCGGTGAACTTCTCTCAGGAA

GAAGAGGAAATGCCTGGACCTCACTCATAGGGTTTTGTACTGAGATTGAATATTGCAGAATTGCAGCAGTCCTGTTTCT - UNI10435 - GGCTTGC

ACTTTTCAGCTACACCTGCTTATCGTCGAGCAGGACAAAGTGCCCTGGAAGGTGGAGAGAGAGGCATCAGTAGCAAAGGATCCAG - UNI23281 - -

 UNI24917 - GCAAGAAGGGGTCCAGCCATTGTTCTTGAGACAGAAACTCAGAGCAGATCAACAGGAAGAAATGGCTGCTTCTCCA GGTCTGTTGAC

ATTCGGGGATGTGGCTTTGGACTTCTCCCAGGAGGAGTGGGAATGCCTGGACTCTGCTCAGAGGGCTCTGTACATTGATGTGATGTTGGAAAATTACATC

AACTTGGTCTCTGTTG AGAAGCATCACATGTGTGGTAAATATGAGAAGGTCTTGGATCAACACTCAGAGCATCAACATGTGAATATCCAAGAAAAGTCT

TACAAATATAAAGAGCTTGGCAAAATGGTTCATGAATCCTCTCCATGTACACCTTATAACACAAGTAGTACTGCAGAAAACTGTAACAAGTACAGCTACC

AGGATGCTTCCATTGAATCATCCCTAATCAGACATAATAGTGTACACACTGGAGAAGAACTTTTCAAATATAAAGAGTGTGGCAAATGTTTATGTTCCAA

CATTTGTCCAAATCAGAGTATCCACGATATAAAGATGGAACACAAGTATACAGAAAGTGATAAGCTTTGTGGCTCTACACACAGACTTGTACAGCAAAGA

ACTCATAGTGGAGAGAAAGCACACAATTGTGGGAAATGCTTTAGGAGTTGCTCAAGCCTCAGTACACATCAGAGACTTCACACTGGAGAGAAACCATGGA

AATGTAAAGAATGTGGTAAGTCCTTTAAGTGGTTGTCTCATCTTAAAGCCCATTGCAGAATCCATACTGGAGAAAAACCTTTCAAATGTAATGAATGTGA

TAAAGGCTTTTCACGGTTATCTAGACTTAAAAGTCATTATAGAACCCATACTGGAGAGAAGCCTTACAAATGTGAGGAATGCGGTAAGTGCTTTTCTCGG

TTGTCAAGACTTAAAAACCATTATAGAATCCATACAGGAGAGAAACCTTACAAGTGTAAGGAATGTGGCAAATCTTTTACCCATTGCACGGGTCTTAGTA

CACATCAGAAAATTCATACTGGGGAGAAACCTCACAAATGCAAAAACTGTGGTAAATCCTTTCATCTGCTGTCAACTCTTAAAGAACATTTCAGAGTCCA

CACTAGAGAGAAGCCTTACAAGTGCAAAGAATGTGGTAAGTTCTTCCATTGGTTGTCAGGCCTTAAAAGCCACTACAGAATCCACACTGGAGAGACACCT

TACAAATGTAAGGAGTGTGACAAGTCATTTTCTCAGTTATCAAGACTTAAAAGCCATTATAGAACCCATACTGGAGAGAAATCTTGCAAATGTTTAGAAT

GTGACAAATACTTTACCCAATGCACAGCTCTTAAAAGACATCAGAAAATTCATACTGATGAAAAACCCTACAAATGTGAAGAGTGCAGCAAATGTTTTTA

TGTGTTGTCTCACCTAAAAAGCCATTGCAGAACCCATACTGGAGAGAAGCCTTACAAATGTGAGGAATGTGGTAAGTGCCTTTCTCAGTTGTCAAAACTT

AAAAGCCATTATAGAATCCATACAGGAGAGAAACCTTATAAGTGTAAGGAATGCGACAAATCCTTTACCCATTGCACAGCTCTTAGTACACATCAGAAAA

TTCATACTGGAGAGAAACCCTACTCATGCAAAGACTGTGGTAAATCCTTTTATCTGTTATCAAGACTTAAAGAACATTACAGAGTCCACACTGGAGAGAA

ACCGTACAATTGTAAGGAATGTGGTAAGTTCTTCCATTGGTTGTCAAACCTTAAAAGACATTCCAGAATTCACACTGGAGAGAAACCTTACAAATGTGAG

GAATGTGACAAATCCTTTACCCACTGCTCAAGTCTTAAAGCTCATCAGAAAATTCATGCTGGGGTAAAACCCTACAAATGTGAAGAATGTAGCAAGTCCT

TTTATTGGTTGTCAAACCTTAAAACCCATTCCAGAATCCACACTGGAGAAAAACCTTACAAATGTGGTAAATGTGACAAATCCTTTACCCAGCGCTCTCT

TCTTACAAAGCACAACAGGATCCATACTAGAGAAAAACATGAAAACAGGAAATATGTGAGAACTTTTGATGAATGATTAAATCATAGAAAATTCCAAGAG

TTTATAACTAATTCATGAGGACAAAATGTAGTCAGAAATTCAAACCAGAACTAAACCAGAAGAATGTTCACTGTCGTAAAATCCTCATATCTTATGCATT

AGAAATTCCATGCTAGAAAACCCATGATATGCATTGATTTTTTTTTTCAGTTTTTACCTAGTGCTAAAATTGTAGATACATCTGAAAATTCATCCTGAAG

GGAAACGCAAGAATCTCCTTTAATAATGAGTCCTCTTTTTTTTTTTTTTTAACCTTCAAAATAATCATTCAGGAGTCAAATTGTACAGACAGCGTGAGTA

TGAGAAATGTTAAAGAGATAACTTGTGGATGTGATACATGTACATGCATAGCCTGGAAGTCCCAAAGAATGTGCAGGAAAATTGGTTTTCCTGTACTCAA

GAAAATTGGAAAAGTATTTAGTCCAACTGAAAAACACAATGATTCATATAGAAACACTAAGACACAGACATTAGATAAACAAGTGTATTGCAAAGAAGGA

AACCAAATGCGTAAAGGAATTTGTTATGTACTTGAGTGGAGGAGGATATTTCTATTTGAGTAAATATATAATTCATATTAACATTTGGGTAATGCTAGTA

TTGGAATTTGATGAAATGTAAACACAATAGTTTTTTTTTTTTATACTCAGATGCATCTATGCTGTCTTGCTTACAGATGATTTTATGATAATGTGTATCT

ATTGTTGCTGCTTCAGTGCTGATGAATCTGAGTCAGGAGTGGTGAAGTTAGGTAGCTAATGACTGCTAACCATCTGGTGAGTCCAACTATCTAGACCGAC

TCATGATGGCAAATTTAGAGTCTCCCTGGGTCACGTCTTCATGCAGATGCTGCACAGACCAAGGCCTCTCTGCTTGATGACCTTTTGAAAACTATACTAG

TTCATGGCAGTGTTACAGTCCCAGAGAGAATTCTGTCATTGTGTGCCTGTGAAGACCACTTTAAAAAAAAAACAAAAAACAAAAAACAAACAAACACTTA

TCTCCGATTATTTTCTTCATTGGTTCACTATGTAAAAAGCCATGGTAACCTGAGCAGAATCCTGTCTTGGAATCCCTTTGGTTTCAGGAGTTATTCTTCG

CCTTTATTTGTTGTTACATGGTGGTTGAAGTGCCCTACTCTGTTGGAGTTCACTTTTCTTTGTGTGAGCAGGATTCTGAGATCATGGTACCTTACAGGCA

ATGTAGCTTGCTGCCTGTTGCTCCTAACAATCTACTCTCTGTTAATAACGTGTCGTTAATATCACTTGGTCCATGAAAAATTAGTAGTCTAAGCAAGCTT

CAATACTGTAACACAAATGGAGATGAGTTTTATTTTGCAGGAGGAACACGTGTATGATGTATGAGCAATAGGAAGGGAAAAGGGCTATCCAAGTCTTCAA

TAGGCAGACACAGGGGGATCTCAATAATATATTTTAGAAATATCTGAAAAATGATAAGTCCATAGAATTGCTGATCTCTATCTCGATATCCTCGATGAAA

TTTATGTAAAAAAATAGTTATCAAAGGACAGTCAAATCTAATATTTGAGAATATATAGTTGTATTGAACAATGTGTACCATGAAACTCACACCTTGGCTT

TCTTTGAAAATGGTCAATAGTAACTGTAGGTTTCCATATTTTAGTAAAGTAACATCCCTCTTATTGTTATCTATACTTTTTGTAAAACCACATTTATTTT

TAAATGTTCTACAACTCTATGTAAGGTGATTTTTTTAAATAAATAAAACATCTGTGTTT
Translation
 - UNI22720 -  - UNI10435 -  - UNI23281 - - UNI24917 - MAASP GLLTFGDVALDFSQEEWECLDSAQRALYIDVMLENYINL

VSVE EKHHMCGKYEKVLDQHSEHQHVNIQEKSYKYKELGKMVHESSPCTPYNTSSTAENCNKYSYQDASIESSLIRHNSVHTGEELFKYKECGKCLCSN

ICPNQSIHDIKMEHKYTESDKLCGSTHRLVQQRTHSGEKAHNCGKCFRSCSSLSTHQRLHTGEKPWKCKECGKSFKWLSHLKAHCRIHTGEKPFKCNECD

KGFSRLSRLKSHYRTHTGEKPYKCEECGKCFSRLSRLKNHYRIHTGEKPYKCKECGKSFTHCTGLSTHQKIHTGEKPHKCKNCGKSFHLLSTLKEHFRVH

TREKPYKCKECGKFFHWLSGLKSHYRIHTGETPYKCKECDKSFSQLSRLKSHYRTHTGEKSCKCLECDKYFTQCTALKRHQKIHTDEKPYKCEECSKCFY

VLSHLKSHCRTHTGEKPYKCEECGKCLSQLSKLKSHYRIHTGEKPYKCKECDKSFTHCTALSTHQKIHTGEKPYSCKDCGKSFYLLSRLKEHYRVHTGEK

PYNCKECGKFFHWLSNLKRHSRIHTGEKPYKCEECDKSFTHCSSLKAHQKIHAGVKPYKCEECSKSFYWLSNLKTHSRIHTGEKPYKCGKCDKSFTQRSL

LTKHNRIHTREKHENRKYVRTFDE

For any suggestions or comments, please send an email to unitrap@crg.es