Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000067931 (BC049807)
Chromosomal location
Chr 17: 21703972 - 21725663 (+)
Description
Putative uncharacterized proteincDNA sequence BC049807 ; [Source:UniProtKB/TrEMBL;Acc:Q6DFU8]
RefSeq_dna
NM_001002008 
RefSeq_peptide
NP_001002008.1 
UniGene
Mm.441097 
MGI
MGI:3040683 
Uniprot/SPTREMBL
Q6DFU8 
Human Ortholog
ENSG00000198633 (AC010320.10)
Omim not available
UniTrap UNI15876
Vector Insertion
Chr 17: 21706092 - 21710820
Public Clones not available
Private Clones OST471187 (lexicon) OST49055 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000088787
Sequence
GGAGGCTGGAAACGTGGGACGAAGAACCAGAAGTGTCAAGGACCTGTCAGGTCCAGAGCTCGCGGCCCTGCCCCGTGGGGAATCGCGTGGTTCAGACCTG

GGGTCAGAGGACACAGAGGACTTCGTGGGAAGCTAAAACTCCAGGCAGCCGCGGGTGCCTTGCGGGGCATCCTGGAGGAATCAGCAATCAGTCGCAAAGC

GGCGAGAACCGGAGCCAGGCGGCCCTGGAACCGCCCAG GGTTCGCTGATCACCCAGACCTGCTTATCTGTGGAAACCTAGAAGGTGGAGAGGGAGAACA

CAGTAGCTAAGGATCCAG - UNI15876 - GACTACAAGCTGGCTATTCATCATTCCTGACAGAGAAATTTAAAGAAGAGAAACAAACAAACAAAAAA

AAATGGCTGATTCTCCAGTAAACATGTCCCAG TTTGACCCATTGATATTAAAGGACCACTAGCCAACTATTCATTCTTCCTCAAAGAGAAAATCAAAGA

AGAGACACAGAAAGAAATGGCTAAATCTCCAGTAAACATGTCCAAG CATCTGTTAACATTTCGAGATGTGGCCGTGGACTTCTCCCAGAAGGAGTGGGA

GTGCCTGGACTCTGCTCAGAGGGCTTTGTACATTGACGTGATGGTGGAGAATTATAGCAACCTGGTGTTTGTGG AGAAATATTCTGTACGTGATACTGT

CCATCAACATGTGAGGACTGAAAAGGAGTCTCGTCAGTGTAATGAACTTGGTGAAATGCTTCATGAACCCACCAACTGTGCACCTTATAATACAAGTGAC

ACTACAGAAACCTCTAACAACTACAGATGCTGTAATGACCAGGATGCCTCTGTTGACTCTTCAAACCCAGATAGACTTAAAAGCGTGCACACTGGAGAAG

AACGTTGTGAATATAAAGACTGTGAGAAATCTTCCAGCATTGCTCAAGATCAGAGAACAAACAGTGCAAACAAAGAACAGAGACAGGAAAAACATGGTGG

CCATTTCAGCTCTACACACAGTCTCAAATCTTCCAGCATTGCTCAAGATCAGAGAACAAACAGTGCAAACAAAGAACAGGGACAGGAAAAACATGGTGGC

CATTTCAGCTCTACACACAGTCTCATGCAACAAGCAATCTTCAATAGAGAGAAACGATACCAGTGTGGGCAATGCCAGAGATGCTTCAGTACCTCCGCAA

ACCTCACTATACATCAGAGAATTCATACTGGTGAGAAACCCTACAAGTGCAACTTTTGTGACAAATCCTTTGCCCAGTGTACAACTCTTAAAACACACCA

ACGTCTTCATACTGGAGAGAAACCTTACAAATGCAAAGAATGTGGAAAATCATTTCCTCAGTTGTCAGCACTTAAAAGCCATCAGAAAATGCATACTGGA

GAAAAGCCTTACAAATGTAAGGAGTGTGACAGATTCTTTGCCCACTGTTCCAGTTTCAGGAGACATCAGAAAACTCATAGAGCTAAGAAACATACTGGCC

CAGATTGTGGTAAAGACTTGCATCAGCTTTCACACTTTAAAAGCGATCACAGACTCCATACTGGAGAGAACCCGTACAAATGCAGTGAGTGTGACAGATC

CTTTCCCCACTATGAATTATTTAGAATTCATCAAAAAACTCATTCTTCAGAAATAGATTATGAATGTGAAGAATGTGGTAAGTCCTTTACTGAATTATTA

CAACTTAGAAGGCATTACAAAATCCATTCTGGTGCAACACTTTACAAATGTAGAGACTGTGACAAATCCTTTACCCAGTATTCACATCTTCAAAAACATC

AGACAATTCATACTGGAGAGAGACCTTACAAATGTAAGGATTGTGAAAAATCCTTTCTTCATAACTCACTTCTTAGACGACATCAGAGTGTTCATACTGG

AGAGAAACCTTATAAATGTAAGGAATGTGACAAATCTTTTACTAGAAACTCCATTCTTAGACAACATCAGAAAATTCATACTAAAGAAAAGCCTTACAAA

TGTGTAGAATGTGACAAGTCCTTTACCCAGCTCACATATCTAAGAACACACCAAAGAGTTCATACTAAAGAGAAACCTTACAATTGTACAGTATGTGACA

AGTCCTTTACAACGGGAGCAACTCTTAGAATACATCAGAGAGTTCATACTGGAGAAAGACCATACAGATGTACGGAATGTGGCAAATCTTTTCGTGAAGG

CACAACTCTTAGAACACATAAGAAAATTCATACTGGTGAGAAACCTTACAATTGTACTGTATGTGACAAATCTTTTATCAGGTACTCACATCTCCAAAGA

CATCAGAGAGTTCATACGGGAGAGAAACCTTACAAATGTATGGAATGTGACAAATCTTTTACTGAGTGCTTTCTTCTTAGAAAGCATCAGAGAATTCATA

CTGAAGAGAAACCTTACAAATGCAAAGACTGTGACTTAGCCTTTGTGTGTATTTCAAATCTTAGAAAACATCAGAAAAATCATACTGGAGAAAAACATAC

TGTTGTAAATAATATGACATAACATTTATGTGGTGTTCCCTGCTTACAAATCACAAGGGAATAAGTAGTAGACTCACAAAGATAACAAGTTTGTGAAATC

CTGTAATGAAGATTGAAGTCTTTAAAAATGTAACAAAGTTTATATTAAAATAAAAATTCTGTAAATG
Translation
  - UNI15876 -  MAKSPVNMSK HLLTFRDVAVDFSQKEWECLDSAQRALYIDVMVENYSNLVFVE EKYSVRDTVHQHVRTEKESRQCNELGEML

HEPTNCAPYNTSDTTETSNNYRCCNDQDASVDSSNPDRLKSVHTGEERCEYKDCEKSSSIAQDQRTNSANKEQRQEKHGGHFSSTHSLKSSSIAQDQRTN

SANKEQGQEKHGGHFSSTHSLMQQAIFNREKRYQCGQCQRCFSTSANLTIHQRIHTGEKPYKCNFCDKSFAQCTTLKTHQRLHTGEKPYKCKECGKSFPQ

LSALKSHQKMHTGEKPYKCKECDRFFAHCSSFRRHQKTHRAKKHTGPDCGKDLHQLSHFKSDHRLHTGENPYKCSECDRSFPHYELFRIHQKTHSSEIDY

ECEECGKSFTELLQLRRHYKIHSGATLYKCRDCDKSFTQYSHLQKHQTIHTGERPYKCKDCEKSFLHNSLLRRHQSVHTGEKPYKCKECDKSFTRNSILR

QHQKIHTKEKPYKCVECDKSFTQLTYLRTHQRVHTKEKPYNCTVCDKSFTTGATLRIHQRVHTGERPYRCTECGKSFREGTTLRTHKKIHTGEKPYNCTV

CDKSFIRYSHLQRHQRVHTGEKPYKCMECDKSFTECFLLRKHQRIHTEEKPYKCKDCDLAFVCISNLRKHQKNHTGEKHTVVNNMT

For any suggestions or comments, please send an email to unitrap@crg.es