Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000067998 (4833413D08Rik)
Chromosomal location
Chr 2: 154083607 - 154096977 (+)
Description
RIKEN cDNA 5430413K10 gene Gene [Source:MGI Symbol;Acc:MGI:1918675]
RefSeq_peptide
NP_780376.2 
UniGene
Mm.389341 
MGI
MGI:3767993 MGI:1918675 
Uniprot/SWISSPROT
Q80XI7 
Uniprot/SPTREMBL
A2AJD0 
Human Ortholog
ENSG00000125997 (AL355392.7-201)
Omim not available
UniTrap UNI14076
Vector Insertion
Chr 2: 154096034 - 154096744
Public Clones CMHD-GT_140B4-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 99% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000088924
Sequence
GAGAAGCAGCTCCTGAAGACAGCAAACCTTCAACAAGGGGCAAG GTTTCAGCCACAAAGATGTGGGTTCTCCAGGCCTTGGCCATCATGTTGAGCATCC

AAGCGGGAACACTTGACCTGGTGGAAACACCCCCAGTGGTGGGCAATCTTCCTGTTGCCATGCCTGTTCCACTCAATCTCCCTGTAGGAGGCCTAAGTCC

TCCAGTCCTCAAAGGACCAGTCAACCATCAAATGTTACCTCCTAAAAGGCCTGTACCTCCACCCAAAGGTGGCAAGTGTGCACCTGCAGCCAGATACTTC

CTCTCCAGTGACAAACTCCATGACT ACCTCATGAGCACACTGCCCCCACAGATTGAGGACATGGTGAAGTGTGATGAAGTTAACCTGGAAGGCATGCTT

GCGGATGTGTTGAACACTGTGGAGAGCTCTGACCTGCTCTCCCTCTTAGATGGCATTTCCCTCCTAAAAGGAGGAGAAGGGGGAGGCCTTGGCATTGGTG

GACTCCTAGGCAATGAAGGCAATGGGGATTCCTCAAAGCCCTCATCAGGCTCCAAGGCCACTGGTGGTCTTGGCCAGCTAATCCCAGGGGGCATCCCAGG

CACGGAGGCCCTGGGCGGCCTACTAAACCTCGGTGGAGACAAGAGCTCTGGAAAAGGGCTGCTGAATGGGGATGGGCTCTCCAAAATCAAGAAGCCTCTT

GAGGATGCAGTTGAAAATGTGAGCGGTATAAAAGATGCCATTCAGGAGAAAGTGAATGAAGTGGTCCCAGATGGCGTCAAGGAGCCACTTAACGATGTGC

TCAAGATGGATATCAAAGACACTCTGCTCGA ACTGAAGGTCGGACAAGTAACTTTGGACGACATGGAGATAAACATGGAAGCTAATGGCATGCAAGTTC

TCTCCATGCTTACTGCTACCATAGATGGAAAAGG CGTGCTTGGACCAGTCATCAGCCTACTGCAGTTTGAAGCTAAGATGGATGTAATGACGACAATTG

CTGTTGCCTCCAACAACACCCAGTGTGTCAACCTTGATGCCCAAGACACCCACATGCATGTCAAGGAAATGAAAATTCAGTTAGTGGAGAC AGTCACAG

GAAAAGTGCCTCTGCCTGTGCCTCTGCCCTTGGATCAGATCATCCCAGCAATAGTGACAGCAAAAATAAATGAAAAT CTGGAAAAATCCAACTCCTGTG

CCATTGTCCTCAATGACTTCAACAACTGCAAGAACA ATACCGGCTTATTCAGTTACCAAGTTAATACTGCCAGGATCTCTCCAAAAGGACTTGTCATCC

TCTACTGT GCTAAAGCCAATATAGGCAACAAAACAGTACCTGTGCCTGGAGGTCGGCTGCCTCCAGATCCCAAAAATGCAAGCATTGCGGTAACCATTT

CCTCCACAACACTGAAGACACTTGTAAAAGAAGTGGCCAAGAATAGCTCTGTGCAG ATGGATGGCCTGGAAGCACAAATCACCCACATAGCGTTTGCCT

CCCAGGAAAACAATACGCTCAGAGTCGTGTATAAGGTTGACATAACAAAGAACGGAGAGCACTTTGCCACTGGGGAAACG AAATTATTCATCTCCCATG

GCAGCAAGATTTCAAACTCCACACTGATACCAGATGTCAAGCTCATAAG GTCTGAGCACAGTGTGGTGCCTCCTGAGGCT AAGGAAGAAGTAGAAGGC

ATTTTGTCTGAAGTAGGAAAGGTGGCCTGGTCCAACTTCAATG AAACGTATAAAAAAATGAACATTCCTGTAGGTGTGTCTTCACATACTTTAAAGAAC

TCCGATGTCAAATTGATGAAATCA - UNI14076 - ATTGACCTTCAGGCAGCAAGCTGAAGCCACTACTGAACCCCAAGTACTGAATGACAGCAAAC

CCCTGAGAATTGTCTCCATGCCCCTTTCAGCCCATCCTTATGATTCAGGAGACAATAGCAATGGTCTCCTCAGTATGCCCAGGATCCTCTGCCCTGAGTG

ACAAGGACAAGAACAGTTGGAGGAAATGGGCATTGTTGTAATCAGCTCCTTAATAAACACTCCCTGCATGC
Translation
 MWVLQALAIMLSIQAGTLDLVETPPVVGNLPVAMPVPLNLPVGGLSPPVLKGPVNHQMLPPKRPVPPPKGGKCAPAARYFLSSDKLHDY YLMSTLPPQ

IEDMVKCDEVNLEGMLADVLNTVESSDLLSLLDGISLLKGGEGGGLGIGGLLGNEGNGDSSKPSSGSKATGGLGQLIPGGIPGTEALGGLLNLGGDKSSG

KGLLNGDGLSKIKKPLEDAVENVSGIKDAIQEKVNEVVPDGVKEPLNDVLKMDIKDTLLE ELKVGQVTLDDMEINMEANGMQVLSMLTATIDGKG GVL

GPVISLLQFEAKMDVMTTIAVASNNTQCVNLDAQDTHMHVKEMKIQLVET TVTGKVPLPVPLPLDQIIPAIVTAKINEN LEKSNSCAIVLNDFNNCKN

N NTGLFSYQVNTARISPKGLVILYC AKANIGNKTVPVPGGRLPPDPKNASIAVTISSTTLKTLVKEVAKNSSVQ MDGLEAQITHIAFASQENNTLRV

VYKVDITKNGEHFATGET KLFISHGSKISNSTLIPDVKLIR RSEHSVVPPEA KEEVEGILSEVGKVAWSNFNE ETYKKMNIPVGVSSHTLKNSDVK

LMKS - UNI14076 - IDLQAAS

For any suggestions or comments, please send an email to unitrap@crg.es