Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000068117 (Mei1)
Chromosomal location
Chr 15: 81912906 - 81957241 (+)
Description
meiosis defective 1 Gene [Source:MGI Symbol;Acc:MGI:3028590]
UniGene
Mm.289351 
MGI
MGI:3028590 
Uniprot/SWISSPROT
Q9D4I2 
Human Ortholog
ENSG00000167077 (MEI1)
Omim not available
UniTrap UNI32272
Vector Insertion
Chr 15: 81946289 - 81953851
Public Clones IST14953F9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000089178
Sequence
AGCTCCTCCAACAGTCCACTGGGAAAACAGATGGAAAGTCTTTATGTTCTCCTCTGGAGTTTTGGCTAGAGCAGGGTGCTCAGGAAG TTTCTCCTGTCC

AGAGATGAGATCCTGCAGGTGGCCAGCTCCCACTGTATAACGGCAGTGCTGGTCCATTCCCCGGCGAAGCATGCTGTTGCCTTCATTCACGCTGACATCC

CAG AGTTCCTCTTTGAGCATCTTTCGTCCTCCAGCGAAATCCTTGTCTGGTCCAGCTACAACTGCCTGATACTCTTGGCAGAAGAACCGCTCTTCTTTT

CAAAGTGTCACACAGTGTATG GGATCGAGGCAGTGGTCAGGAGCCTCCAGGGCAGCCAGCAGATGACCAACACGGAACTGCATACTCAGGGACTGCTGC

TCTTCAAAGAAATTCTGACTCG GCAGCCAGAGGAGATCAGGCTGTTCACAAGCTCAGCCCTGTGCAGAGATGCCAGCCGTGCCCTCCAGGAGGCCGTGA

GCAGCCCTGTGTTAGCTGTGGCCGCCGAAGCACTGAGGGCCATTTCAGCTTTTCTGAG GAAGGACCATCAGAGCTCTCTGCCCGTGCAGTACAGAGCAC

TTCGTGCCTTGCTTGAAGCCATGCTGAGCCGATGTATGGAGTTTTCCCAGACCCCTCTGAACAGGAGGTCCCTG GGCCACGCTTGCAGTAGAAACTCGG

AGAAGGCCACTCTGAGAAAGGGGAGTTTCCTCCTGAGCACTCTGGAAGGCTTTAGAAATGCCTGCAG GCTGGCTGTGGAATTCCAAGGCGAGCCTTCCG

CCCAGGAGAACCCCTTCACAGCTCCCAGTGCAGAGAAGGAAGACACCTTGGAGGCCTTCTCAGAGTATCTTCTCAGTGCCTGTGACTCCCAGTGCATCCC

GATGGTGATG AGGTACTCGGAGGAGGCCACGCATCCAAAGCTGATGGAGGTTTTCCTCTCCATTCTACACAGCCTCTTTGTCATCATTCCCCACATGAA

GGTGAAGTTCTCCAGGAAGCTTG CTGATTCATCATTCATACGACTGACCCTGGAGCTGAAGGCCAGATTCTGCAGTGGCCAGAG TCACTCGTCCCTAA

ATCAGGTGTGCTCCAGTTTCCTCTACTACATGTGCCTCAATCTCCTCTCAGCTCCAGAGAAGACAGAACCACTTTCCCAAGAAG AACTCTCTGCAGTGT

CTGAGTTCCTACAGCATGGACTGCCCCACATAAGCAGCAGGACCCCAGAAAGCCTTGCCTTCCTGTCAGATCGGCAGTATGTGGAGGCGGCCACGCGCCA

GAGACAGTACTGCATCCTCCTCCTCTTCTACCTGGCTCACATCCACGATGACAG GTTTGTCCCTGAGGCGGAGCTCTTTGTGGCTGTGCAGAGCTTCCT

TTTGTCTCTGCAGGACCAGGGTGAGTGCCCGCCACCAGTGGTCTGCAAAGCCTCCATGTATCTGCTGGCAGTGTGCGGGGACAAGGACAGTGCACTGGCT

GAG GCCGTGATCAGTGCAATCAGAAAGTTCCTAGAGGGCATCCCAGACCTGCGTGGGGTCTACACTCACCACCCGCTCCTGCTCAGGTTCTTCCTGGCC

TATCCAGGGTTGATGAGCAGGTTCGGGCACCGTGTCTTGGAGCTTTGGTTCTCTTGGGAAGAGAGCGGCTACGAGAACCTAGATGATGACTCCTCTCCTG

GGCGTACAGTCTTTCCCGCCAACCTCGCAGCCCTGTTCCGTGTGCTCCAGAGCACGCCCAGCATCCTACTCATTTTGCTG GACCTGGTCTATTCCAGCC

CCGTGGATACAGCCCGAAAGGTCCTGATTGTCCTGAGGGTGTTCCTTTGGGAGAATGAGGATGTCAAGGTGGGTGGCCTCATCCGAGGCCACTTTCTGCT

CATCCTGCAGCGCCTCCTGGTGGAGTATGGAGCGTCCACCTCAGGAG GGAACCTGCCGCTGCTGCTGAACCTCCTGTCCTTGGTGCAGATGAGGAATGA

GTCGGAACAAGAGCTGGACAGCATGGCCATGAAGCTGCTTCATCAAG TGAGCATGCTGTGTGGGAAGTGCAGCCCTGCACATGTGGATATCCTGCAGCC

CTCCTTCAACTTCTTGTACTGGAGTCTTCATCAGACCACACCCAGTAGCCAGAAAAGAG CTGCTGCTGTCCTGCTGAGCAGCACAGCCTTGCTTGAGCT

CCTGGAGAAGATGCTGGCCCTCACCTGGACGGAAACAGGCTCCTCCCCCAGGACGCCACTGCTCTCCTCTGCCTGGCTGCTCACTGCCTCCTTCTCTGCC

CAGCAGCACAATGGCAATTTGCAG GTCCATCGGACATTATCTGTGGAACTGAACCAAGTATTGAAGGCTCTCAGCTTTCCAAAGAAGATGTCTGCATTG

CTGTCAG CTGCCATCCTACGATTCCTGCGGACAGCCTTGCAACAAAGCTTTTCCTCTGCCTTGGTGGTCTTGGTACCCTCAGGGGATCAACCGCTGTCA

ACTCCTGAGGACGCTGTCCTAGCTCCGCTAGGAAAGTCACAAGTGCTAGCCCTGTTAATTGGGCTCCAGAACCTCTTGGTACAG - UNI32272 - AA

AGACCCTCTGTTATCTCAAGCCTGTATTGGCTGTCTGGAAGCCTTGCTAGATTACTTGCATGCCAGGAGCCCAGACATTG CGCTCCATGTGGCCTCCCA

GCCCTGGAATCGGTTTCTGCTGTTCACCCTCTTGGATGCTGGAGAGAATTCCTTCCTCAGACCTGAGATACTGAGACTTATGACCTTG TTTGTGCAGTA

CCGGAGCAGCTGTGTCCTCTCACGTGAAGAGGTGGGTCTTATTTTGCAAGGTGCAGCTTTGGTTGACCTGTCAGCTCTCTCAAACGATACACTCCAGGCC

CTGCATGGCTTCCTCCTGCAG GTCCAGAGCATGGGTCTCCTAAATGACCAACACATGACCCAGACCTTGCAATCATCTTTGGAAGGCCTTTGCTCCCGC

ACCTTCCCAGCCCAGCCACTCTTTCAAGACATGCT CTGCCTCGGAGGTGTGTCTGTTTCCCAGGCTCACATCAGAGGCTGAGCCTCAGGACATAAAGGC

CCAGAAACAGAAAACAATGAGACCTGCAGACAAATTCCGGGCATAATGGTTGAGGGGGAAAACAATATCAAGCCTCTCTCTGGAGCTATTTTACACCACA

GTGGAAATGGAATTGGGAAATAAAATAATGCATT
Translation
   MTNTELHTQGLLLFKEILTR RQPEEIRLFTSSALCRDASRALQEAVSSPVLAVAAEALRAISAFLR RKDHQSSLPVQYRALRALLEAMLSRCMEF

SQTPLNRRSL GHACSRNSEKATLRKGSFLLSTLEGFRNACR RLAVEFQGEPSAQENPFTAPSAEKEDTLEAFSEYLLSACDSQCIPMVM RYSEEATH

PKLMEVFLSILHSLFVIIPHMKVKFSRKLA ADSSFIRLTLELKARFCSGQS SHSSLNQVCSSFLYYMCLNLLSAPEKTEPLSQEE ELSAVSEFLQHG

LPHISSRTPESLAFLSDRQYVEAATRQRQYCILLLFYLAHIHDDR RFVPEAELFVAVQSFLLSLQDQGECPPPVVCKASMYLLAVCGDKDSALAE AVI

SAIRKFLEGIPDLRGVYTHHPLLLRFFLAYPGLMSRFGHRVLELWFSWEESGYENLDDDSSPGRTVFPANLAALFRVLQSTPSILLILL DLVYSSPVDT

ARKVLIVLRVFLWENEDVKVGGLIRGHFLLILQRLLVEYGASTSGG GNLPLLLNLLSLVQMRNESEQELDSMAMKLLHQV VSMLCGKCSPAHVDILQP

SFNFLYWSLHQTTPSSQKRA AAAVLLSSTALLELLEKMLALTWTETGSSPRTPLLSSAWLLTASFSAQQHNGNLQ VHRTLSVELNQVLKALSFPKKMS

ALLSA AAILRFLRTALQQSFSSALVVLVPSGDQPLSTPEDAVLAPLGKSQVLALLIGLQNLLVQ - UNI32272 - KDPLLSQACIGCLEALLDYLH

ARSPDIA ALHVASQPWNRFLLFTLLDAGENSFLRPEILRLMTL FVQYRSSCVLSREEVGLILQGAALVDLSALSNDTLQALHGFLLQ VQSMGLLNDQ

HMTQTLQSSLEGLCSRTFPAQPLFQDML LCLGGVSVSQAHIRG

For any suggestions or comments, please send an email to unitrap@crg.es