Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000068130 (Zfp442)
Chromosomal location
Chr 2: 150232877 - 150277222 (-)
Description
zinc finger protein 442 Gene [Source:MGI (curated);Acc:Zfp442-001]
MGI
MGI:3651999 
Uniprot/SPTREMBL
A2AQA0 
Human Ortholog
not available
Omim not available
UniTrap UNI3370
Vector Insertion
Chr 2: 150237074 - 150277137
Public Clones AF0722 (sanger) XS0248 (sanger) XR0170 (sanger) (ggtc)
IST13331F4 (tigm) IST13097D3 (tigm)
Private Clones OST166317 (lexicon) OST65655 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37682
Vector Insertion
Chr 2: 150236676 - 150237074
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109916
Sequence
TCCTCTCTGAAGCTGAGCAATCTGGAGTGTATCTTCTTGGCGTGTTCTGTGTGCAGGCTCAGACAAGCTCAGAAGTCCCGACATG - UNI3370 - GG

TGTTGTGACCTATGATGATGTGCATGTGAACTTCACTCAGGAAGAGTGGGCTTTGCTGGATTCTTCTCAGAAGAATCTCTACAGAGATGTGATGCTGGAG

ACCTACAGGAATCTTGCTGCTATAG GCTACAGTTGGGAAGACCATAATCCTGAAGAACATTTTCAAAGTTCTAGAAGACATGGAAG GCATGAAAAAAG

TCATATTGAAGAGAAACCCTCTGAATTTACTCAATGTGGTAAAGTCTTTGCGTATCAGAGCCATCCTCAGGGGCATCAACAAATTCATACTGGAGAGAAA

CCCTATGAAGTTATTCAATATCTTGAGGCATTTGCATATCACAGTAGTCTCCAAATACATAAAAGAACACATGGTGGAGACAAACACTATAAGATTAATG

AATGTGGTAAAGCCTTTGCATGTCACAATTCTCTTCAAAGGTATAAAAGAGTTCATACAGGTGAGAAACTTTATGAATGTAATCAATGTGGTACTGACTT

TGCACAACACAGTCATCTTCAACAGCATGAAAGAATGCATACTGTTAAATGTAAGCAAAGTGGAAAAGACTTTGCATGTTATACTAATCTCCAAATATAT

CAAAGAACGCATACTGGAGAGAAACCTTATGAATGTATATTCTGTGATAAAACCTTTATACATCACAGTCATCTTGAAAGGCATGAAAGAATTCATACTG

GAGAGAAACCCTATGAATGTAACCAATGTGGTAAAGCCTTTTCACAAAACAGCAGTCTCCAATTACATAAAAGAACACATACTGGAGAGAAACCCTATGA

ATGTAAGCAATGTGGTAAATCCTTTGCATGTCAGAGTGGTCTCCAACAGCATAAAAAAACACATCATGGAGAGAAATCTTATGAATGTAAACGATGTGGT

AAAGCCTTTGCATGTCAAAGTGATCTGCAACAGCATAAAAGAACACATACTGGAGAGAAATCCTATGAATGTAACCAGTGTGATAAAGCCTTTGCTCTTC

GCTGTCATCTTCGAAGGCATCAAAGAATTCATACTGTAGAGAAACCCTATAAATGTAATCAATGTGGTAAATTCTTTGCACAAAGCAACCATTTTGTACG

ACATAAAAGAACACATACTGGAGAGAAACCCTATGAATGTAATCAATGTGATAAAGCCTTTGCATGTCAAACTAGTCTCCTGTATCATAAAAGAACACAT

TCTGGAGAGAAACTCTATGTCTGTAATGAATGTGGCAAAGCCTTTGTACTTCAAAGTTATCTTCAGATACATAAAAGAACACATACTGGAGAGAAACCCT

TTGGATGTGACCAGTGTGATAAGGCATTTGCACAAAACAGTCATCTCCTAACACATAAAAGAACACATACTGGAGAGAAACCCTATGAATGTGAGCAATG

TGGCAAAGCCTTTGCAAGTAATAGTAATCTCCAAGTGCATAAAAAAACGCACACTGGAGAGAAACCCTATGAATGTAAGCAGTGTGGTAAAGCCTTTGGG

TTTCAAAGTGGTCTGCAAAAGCATAAACGAACACATACTGGAGAGAAACCCTATGAATGTAATCAGTGTGATAAGGCATTTGCATGTCAAGCTAGTCTCC

TGAATCATAAACGATCACACACTGGTGAGAAGCCATATGAATGTAGTGAATGTGGTAAAGCGTTTGTACTTCACAGTTATCTTCAAATACATAAAAGGAT

ACATACTGGAGAGAAACCCTTTGAATGTGACCAATGTGATAAAGCCTTTGCTCGAAACACTCTTCTCCTAAAACATAAAAGAATACATACTGGGCAGAAA

CCCTATGGATGCAAGCAATGTGGCAAAGCCTTTGCAAATCACAGTAATCTCCAAGTGCATAAAAGAACACATACTGGAGAGAAGCCCTACGAATGTAAGC

ACTGTGGTAAACCCTTCAAGTGTCAAAGTGGTCTGCAGTATCATAAAAGAACACAACACATACAGGAGAGAAACCCTATGACTGTAATCAATGTGATCTA

GTCTTGGCATGTCAGACATCTTCAGAGCACTAAAGAAACATTATTGTATAGAATCTCTGTGAGTATATTTAATATGGTGAAGCCTTTGTACATTTCTATC

GTCTTCATCTTTATGTAAGAAATCCATACTGAAGGGAAACTGTGAATGTACACTAACTACATCAGATCAAGCCTTTTCATATTTCACAAGCCTTTGTCAT

CATGAAATAATTCATACTGGGGCAAAACTTGAATATATTTAATATGGTCAAACATTTGAACATTTCTGCCATCTTCATCATCATGAAAGTATTTCTCCTG

GAGAGAAACTCTATGACTGTAATGGATTTGTGATATGTATAGCTGTCACACTAACATTCAGTTATAAAAGATTAGACAAAAAAAAGTGACAAGTGCCAAC

AATCCATTCAAGCATTACGATGTGATGTGCCTCTTTCTTTTGTCTGCACTTGCAAACACAGTAAACCTTGTTTATTTTGTTTGCACTTATATTCCTCAAC

AATTATATGAAATAGCTCATCCAGGTATAATGCTTTTTATTTTGAAAGATTTTGAGTAGGTATTGAAGGTTGTTCTATGTTTTGCAAATATATTTACAAA

AGTGCTTTTTATGTTTCTGTAGTAAAACACTATGTCTAAAGCAGCTTATAAAAGAGGTTAACCTAGCTCAACCAAAATAGTCATAAGCAGCAGATGGAGG

GAGGGAGATGGGATGGAATGGCGGCTTCAACATCAGGTGTGGAGAGAACAGGAGAGATGGCTAGATGGCCACGAATATGAATGGAAATATACAATTTATG

GGAGAGAAGGAAGGGGAAATCTACAGGAAAAGAAAAA
Translation
M - UNI3370 - GVVTYDDVHVNFTQEEWALLDSSQKNLYRDVMLETYRNLAAIG GYSWEDHNPEEHFQSSRRHGR RHEKSHIEEKPSEFTQCGKV

FAYQSHPQGHQQIHTGEKPYEVIQYLEAFAYHSSLQIHKRTHGGDKHYKINECGKAFACHNSLQRYKRVHTGEKLYECNQCGTDFAQHSHLQQHERMHTV

KCKQSGKDFACYTNLQIYQRTHTGEKPYECIFCDKTFIHHSHLERHERIHTGEKPYECNQCGKAFSQNSSLQLHKRTHTGEKPYECKQCGKSFACQSGLQ

QHKKTHHGEKSYECKRCGKAFACQSDLQQHKRTHTGEKSYECNQCDKAFALRCHLRRHQRIHTVEKPYKCNQCGKFFAQSNHFVRHKRTHTGEKPYECNQ

CDKAFACQTSLLYHKRTHSGEKLYVCNECGKAFVLQSYLQIHKRTHTGEKPFGCDQCDKAFAQNSHLLTHKRTHTGEKPYECEQCGKAFASNSNLQVHKK

THTGEKPYECKQCGKAFGFQSGLQKHKRTHTGEKPYECNQCDKAFACQASLLNHKRSHTGEKPYECSECGKAFVLHSYLQIHKRIHTGEKPFECDQCDKA

FARNTLLLKHKRIHTGQKPYGCKQCGKAFANHSNLQVHKRTHTGEKPYECKHCGKPFKCQSGLQYHKRTQHIQERNPMTVINVI
Transcript ENSMUST00000089201
Sequence
GGTGTTGTGACCTATGATGATGTGCATGTGAACTTCACTCAGGAAGAGTGGGCTTTGCTGGATTCTTCTCAGAAGAATCTCTACAGAGATGTGATGCTGG

AGACCTACAGGAATCTTGCTGCTATAG GCTACAGTTGGGAAGACCATAATCCTGAAGAACATTTTCAAAGTTCTAGAAGACATGGAAG GCATGAAAAA

AGTCATATTGAAGAGAAACCCTCTGAATTTACTCAATGTGGTAAAGTCTTTGCGTATCAGAGCCATCCTCAGGGGCATCAACAAATTCATACTGGAGAGA

AACCCTATGAAGTTATTCAATATCTTGAGGCATTTGCATATCACAGTAGTCTCCAAATACATAAAAGAACACATGGTGGAGACAAACACTATAAGATTAA

TGAATGTGGTAAAGCCTTTGCATGTCACAATTCTCTTCAAAGGTATAAAAGAGTTCATACAGGTGAGAAACTTTATGAATGTAATCAATGTGGTACTGAC

TTTGCACAACACAGTCATCTTCAACAGCATGAAAGAATGCATACTGTTAAATGTAAGCAAAGTGGAAAAGACTTTGCATGTTATACTAATCTCCAAATAT

ATCAAAGAACGCATACTGGAGAGAAACCTTATGAATGTATATTCTGTGATAAAACCTTTATACATCACAGTCATCTTGAAAGGCATGAAAGAATTCATAC

TGGAGAGAAACCCTATGAATGTAACCAATGTGGTAAAGCCTTTTCACAAAACAGCAGTCTCCAATTACATAAAAGAACACATACTGGAGAGAAACCCTAT

GAATGTAAGCAATGTGGTAAATCCTTTGCATGTCAGAGTGGTCTCCAACAGCATAAAAAAACACATCATGGAGAGAAATCTTATGAATGTAAACGATGTG

GTAAAGCCTTTGCATGTCAAAGTGATCTGCAACAGCATAAAAGAACACATACTGGAGAGAAATCCTATGAATGTAACCAGTGTGATAAAGCCTTTGCTCT

TCGCTGTCATCTTCGAAGGCATCAAAGAATTCATACTGTAGAGAAACCCTATAAATGTAATCAATGTGGTAAATTCTTTGCACAAAGCAACCATTTTGTA

CGACATAAAAGAACACATACTGGAGAGAAACCCTATGAATGTAATCAATGTGATAAAGCCTTTGCATGTCAAACTAGTCTCCTGTATCATAAAAGAACAC

ATTCTGGAGAGAAACTCTATGTCTGTAATGAATGTGGCAAAGCCTTTGTACTTCAAAGTTATCTTCAGATACATAAAAGAACACATACTGGAGAGAAACC

CTTTGGATGTGACCAGTGTGATAAGGCATTTGCACAAAACAGTCATCTCCTAACACATAAAAGAACACATACTGGAGAGAAACCCTATGAATGTGAGCAA

TGTGGCAAAGCCTTTGCAAGTAATAGTAATCTCCAAGTGCATAAAAAAACGCACACTGGAGAGAAACCCTATGAATGTAAGCAGTGTGGTAAAGCCTTTG

GGTTTCAAAGTGGTCTGCAAAAGCATAAACGAACACATACTGGAGAGAAACCCTATGAATGTAATCAGTGTGATAAGGCATTTGCATGTCAAGCTAGTCT

CCTGAATCATAAACGATCACACACTGGTGAGAAGCCATATGAATGTAGTGAATGTGGTAAAGCGTTTGTACTTCACAGTTATCTTCAAATACATAAAAGG

ATACATACTGGAGAGAAACCCTTTGAATGTGACCAATGTGATAAAGCCTTTGCTCGAAACACTCTTCTCCTAAAACATAAAAGAATACATACTGGGCAGA

AACCCTATGGATGCAAGCAATGTGGCAAAGCCTTTGCAAATCACAGTAATCTCCAAGTGCATAAAAGAACACATACTGGAGAGAAGCCCTACGAATGTAA

GCACTGTGGTAAACCCTTCAAGTGTCAAAGTGGTCTGCAGTATCATAAAAGAACACAACACATACAGGAGAGAAACCCTATGACTGTAATCAATGTGATC

TAG
Translation
GVVTYDDVHVNFTQEEWALLDSSQKNLYRDVMLETYRNLAAIG GYSWEDHNPEEHFQSSRRHGR RHEKSHIEEKPSEFTQCGKVFAYQSHPQGHQQIH

TGEKPYEVIQYLEAFAYHSSLQIHKRTHGGDKHYKINECGKAFACHNSLQRYKRVHTGEKLYECNQCGTDFAQHSHLQQHERMHTVKCKQSGKDFACYTN

LQIYQRTHTGEKPYECIFCDKTFIHHSHLERHERIHTGEKPYECNQCGKAFSQNSSLQLHKRTHTGEKPYECKQCGKSFACQSGLQQHKKTHHGEKSYEC

KRCGKAFACQSDLQQHKRTHTGEKSYECNQCDKAFALRCHLRRHQRIHTVEKPYKCNQCGKFFAQSNHFVRHKRTHTGEKPYECNQCDKAFACQTSLLYH

KRTHSGEKLYVCNECGKAFVLQSYLQIHKRTHTGEKPFGCDQCDKAFAQNSHLLTHKRTHTGEKPYECEQCGKAFASNSNLQVHKKTHTGEKPYECKQCG

KAFGFQSGLQKHKRTHTGEKPYECNQCDKAFACQASLLNHKRSHTGEKPYECSECGKAFVLHSYLQIHKRIHTGEKPFECDQCDKAFARNTLLLKHKRIH

TGQKPYGCKQCGKAFANHSNLQVHKRTHTGEKPYECKHCGKPFKCQSGLQYHKRTQHIQERNPMTVINVI

For any suggestions or comments, please send an email to unitrap@crg.es