Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000068134 (Zfp120)
Chromosomal location
Chr 2: 149940142 - 149962414 (-)
Description
zinc finger protein 844 Gene [Source:MGI (curated);Acc:Zfp120-003]
Human Ortholog
not available
Omim not available
UniTrap UNI38688
Vector Insertion
Chr 2: 149945560 - 149962411
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000089207
Sequence
GCAAGTTCCTCTTTTAAAGCTGGCAGTCGCGAATGTTTCTGCTTGATGTGTTCTGTGTACCGCTCCTGGGTGCGGGGACCTCAGGCAAGCCCAGAAGTTC

CGACATG - UNI38688 - GATATAGTGACCTATGATGATGTGCATGTGAACTTCACGTGGGAAGAGTGGGCTTTGCTGGATCCTTCTCAGAAGGATC

TCTACAGAGATGTGATGCTGGAGACCTACAGGAATCTCGCTGCTATAG - UNI38688 - GCTACTATTGGAAAGGCCATAATATTTCTGAAGGACAT

TTTCAAAATTCTAGAAGAAACGGAAG GCATGAAAGAAGTGATACTGAAGAGAAACTTTCTGAATTTACTCAATATGATAAAGACTTTGCATATCAGAGC

CATCCTCAAAGGCATGAAAGAATTTATTCTGGAGAGAAACCCTATGAAGGTGTCCAATATTTTGAAGACTTTGCACATCACAGTAGTCTCCAAATACAGA

GAAGAACACATGTTGTAGAAAAACCCTATGAGTGTAACCAATGTGGCAAAGCCTTTGCATACCACAGTTATCTTCAAAGGCATGAAAGAAGTCATACAGG

AGAGAAACCTTATGAATGTAATCAATGCGGTAAAGCCTTTGGACGGCACAGTCATCTTCAGAGACATGAAAGAATTCATACAGGAGAAAAAAGCTATGAC

TGTAATCAATGTGGTAAAACATTTGTACATCACAGTCATCTTCAAATACATAAAAGAACACATATTGGAGAGAAACCCTTTGAATGTAACCAATGTGGTA

AAGCCTTTGCACGAAACAGTCATCTCTTAATACATAAAAGAATACATACTGGAGAGAAACCCTATGAATGTAAGCAATGTGGTAAAGCTTTTGCTTATCA

AAGTGGTCTCCTCTATCATAAAAGAAGATATACTGTAGAGAAACTCTATGAGTGTAACCAATGTGGTAAAGCCTTTGCATGTCACAATAGTCTCCAAGTA

CATAAAAGAACACATACTGGAGAGAAACCCTATAAATGTAATCAGTGTGGAAAAGCCTTTGGACGCTACAGTTCTCTTCAAAGGCATGAAAGAATTCATA

CAGGAGAGAAACCTTATGAATGTAAGCAATGTGGTAAAGCCTTTGGACGTCACAGTTCTCTCCAAAGGCATGAAAGAATTCATACAGGACAAAAACCTGA

TGAATGTAGTCAATGTTGTAAAGACTGTGGATGTTACAATAGTCTCCAGATACATAAAAGACCACATACTGGAGAGAAATACTTTGAGTGTAACCAATGT

GGTAAAGGCTTTTCACAAAACTGTTATCTTGAAATACATAAAAGAGCACATACTGTAGAGAAACACTATTAGTGTAACAATGTGGTAAAGCTTTTGCATA

TCATGGCCGTCTTTGAATACATAAAGTACCATATACTGCAGAGAAACCCTATGAATGTAATCAATATGGTAAAGCCTTTGCATGTCAGACATGTTCAAAG

GCATGAAAGAAACCATACTGTAGAGAAATCCTGTGAGTGTATTTAATATGGTGAAGCCTTTGCACATTTCTATAGTCTTCATCATCATGAAAAAAAATCC

ATACTGGATAGAAACCCTATGAATGTATTTAATGTGCTAAAGCCTTTTCACATTTCATAAGTCTTCATCATTGTGAAATAATTCATACCAGAGAGAAATG

AATATATTTAATATGGAGAAGTCTTTGTGTATTTTAATAGTCTTTATTCTCGGGAAACTATTCATACTGGAGAGAAATTCTGTGAGTGGGAGCCTTTGTT

TTATGGGGTCCGTTGAGATCCAACAAAACTCAAACTCAGGTAATGCAAGTGACAAGAACTTACTGTACTCAAGCTGCTACTGATAGCTCAGGGCTACAGA

ACATACTTGGAAACTGAACTGTGACATGCTGCCGAACCACTTCCCGACCCAGAGCAGGAGTGGTACAGAGCTTTTAAGTTCCAAAACCAGAAATATCTGT

GCCAAGTTATAGCTCCATTTTTTTTTTTCACCAGGATTTAGGGATCAGGGCTTTCCTTATCTAGTTGATCTATGTTTACTGAAACAGTTTAACTAATCAT

ATCCATTTATTGTTTTGTGATTAGGAACAGGCATTATGTTTTGAGGAACAAAAGATAAATAACAGAAGCCATGGTTAGAGACAGTCAATATGATTTCGTG

AACAAAGATGGACAATAGAAGCTGGCCTGCTATTGGGAAGGTCCCAGCTACTGCAGGGCCAGGGAACTTGAATTAGGTGTACCATATGATTAAATGGAGG

CTGAT
Translation
MFLLDVFCVPLLGAGTSGKPRSSDM - UNI38688 - DIVTYDDVHVNFTWEEWALLDPSQKDLYRDVMLETYRNLAAIG - UNI38688 - GYYW

KGHNISEGHFQNSRRNGR RHERSDTEEKLSEFTQYDKDFAYQSHPQRHERIYSGEKPYEGVQYFEDFAHHSSLQIQRRTHVVEKPYECNQCGKAFAYHS

YLQRHERSHTGEKPYECNQCGKAFGRHSHLQRHERIHTGEKSYDCNQCGKTFVHHSHLQIHKRTHIGEKPFECNQCGKAFARNSHLLIHKRIHTGEKPYE

CKQCGKAFAYQSGLLYHKRRYTVEKLYECNQCGKAFACHNSLQVHKRTHTGEKPYKCNQCGKAFGRYSSLQRHERIHTGEKPYECKQCGKAFGRHSSLQR

HERIHTGQKPDECSQCCKDCGCYNSLQIHKRPHTGEKYFECNQCGKGFSQNCYLEIHKRAHTVEKHY
Transcript ENSMUST00000094538
Sequence
GCAAGTTCCTCTTTTAAAGCTGGCAGTCGCGAATGTTTCTGCTTGATGTGTTCTGTGTACCGCTCCTGGGTGCGGGGACCTCAGGCAAGCCCAGAAGTTC

CGACATG - UNI38688 - GATATAGTGACCTATGATGATGTGCATGTGAACTTCACGTGGGAAGAGTGGGCTTTGCTGGATCCTTCTCAGAAGGATC

TCTACAGAGATGTGATGCTGGAGACCTACAGGAATCTCGCTGCTATAG - UNI38688 - GCATGAAAGAAGTGATACTGAAGAGAAACTTTCTGAAT

TTACTCAATATGATAAAGACTTTGCATATCAGAGCCATCCTCAAAGGCATGAAAGAATTTATTCTGGAGAGAAACCCTATGAAGGTGTCCAATATTTTG 

GACTTTGCACATCACAGTAGTCTCCAAATACAGAGAAGAACACATGTTGTAGAAAAACCCTATGAGTGTAACCAATGTGGCAAAGCCTTTGCATACCACA

GTTATCTTCAAAGGCATGAAAGAAGTCATACAGGAGAGAAACCTTATGAATGTAATCAATGCGGTAAAGCCTTTGGACGGCACAGTCATCTTCAGAGACA

TGAAAGAATTCATACAGGAGAAAAAAGCTATGACTGTAATCAATGTGGTAAAACATTTGTACATCACAGTCATCTTCAAATACATAAAAGAACACATATT

GGAGAGAAACCCTTTGAATGTAACCAATGTGGTAAAGCCTTTGCACGAAACAGTCATCTCTTAATACATAAAAGAATACATACTGGAGAGAAACCCTATG

AATGTAAGCAATGTGGTAAAGCTTTTGCTTATCAAAGTGGTCTCCTCTATCATAAAAGAAGATATACTGTAGAGAAACTCTATGAGTGTAACCAATGTGG

TAAAGCCTTTGCATGTCACAATAGTCTCCAAGTACATAAAAGAACACATACTGGAGAGAAACCCTATAAATGTAATCAGTGTGGAAAAGCCTTTGGACGC

TACAGTTCTCTTCAAAGGCATGAAAGAATTCATACAGGAGAGAAACCTTATGAATGTAAGCAATGTGGTAAAGCCTTTGGACGTCACAGTTCTCTCCAAA

GGCATGAAAGAATTCATACAGGACAAAAACCTGATGAATGTAGTCAATGTTGTAAAGACTGTGGATGTTACAATAGTCTCCAGATACATAAAAGACCACA

TACTGGAGAGAAATACTTTGAGTGTAACCAATGTGGTAAAGGCTTTTCACAAAACTGTTATCTTGAAATACATAAAAGAGCACATACTGTAGAGAAACAC

TATTAG
Translation
M - UNI38688 - DIVTYDDVHVNFTWEEWALLDPSQKDLYRDVMLETYRNLAAIG - UNI38688 - GMKEVILKRNFLNLLNMIKTLHIRAILK

GMKEFILERNPMKVSNIL DFAHHSSLQIQRRTHVVEKPYECNQCGKAFAYHSYLQRHERSHTGEKPYECNQCGKAFGRHSHLQRHERIHTGEKSYDCNQ

CGKTFVHHSHLQIHKRTHIGEKPFECNQCGKAFARNSHLLIHKRIHTGEKPYECKQCGKAFAYQSGLLYHKRRYTVEKLYECNQCGKAFACHNSLQVHKR

THTGEKPYKCNQCGKAFGRYSSLQRHERIHTGEKPYECKQCGKAFGRHSSLQRHERIHTGQKPDECSQCCKDCGCYNSLQIHKRPHTGEKYFECNQCGKG

FSQNCYLEIHKRAHTVEKHY
Transcript ENSMUST00000109931
Sequence
TCTTGCAAGTTCCTCTTTTAAAGCTGGCAGTCGCGAATGTTTCTGCTTGATGTGTTCTGTGTACCGCTCCTGGGTGCGGGGACCTCAGGCAAGCCCAGAA

GTTCCGACATG - UNI38688 - GATATAGTGACCTATGATGATGTGCATGTGAACTTCACGTGGGAAGAGTGGGCTTTGCTGGATCCTTCTCAGAAG

GATCTCTACAGAGATGTGATGCTGGAGACCTACAGGAATCTCGCTGCTATAG - UNI38688 - GCATGAAAGAAGTGATACTGAAGAGAAACTTTCT

GAATTTACTCAATATGATAAAGACTTTGCATATCAGAGCCATCCTCAAAGGCATGAAAGAATTTATTCTGGAGAGAAACCCTATGAAGGTGTCCAATATT

TTGAAGACTTTGCACATCACAGTAGTCTCCAAATACAGAGAAGAACACATGTTGTAGAAAAACCCTATGAGTGTAACCAATGTGGCAAAGCCTTTGCATA

CCACAGTTATCTTCAAAGGCATGAAAGAAGTCATACAGGAGAGAAACCTTATGAATGTAATCAATGCGGTAAAGCCTTTGGACGGCACAGTCATCTTCAG

AGACATGAAAGAATTCATACAGGAGAAAAAAGCTATGACTGTAATCAATGTGGTAAAACATTTGTACATCACAGTCATCTTCAAATACATAAAAGAACAC

ATATTGGAGAGAAACCCTTTGAATGTAACCAATGTGGTAAAGCCTTTGCACGAAACAGTCATCTCTTAATACATAAAAGAATACATACTGGAGAGAAACC

CTATGAATGTAAGCAATGTGGTAAAGCTTTTGCTTATCAAAGTGGTCTCCTCTATCATAAAAGAAGATATACTGTAGAGAAACTCTATGAGTGTAACCAA

TGTGGTAAAGCCTTTGCATGTCACAATAGTCTCCAAGTACATAAAAGAACACATACTGGAGAGAAACCCTATAAATGTAATCAGTGTGGAAAAGCCTTTG

GACGCTACAGTTCTCTTCAAAGGCATGAAAGAATTCATACAGGAGAGAAACCTTATGAATGTAAGCAATGTGGTAAAGCCTTTGGACGTCACAGTTCTCT

CCAAAGGCATGAAAGAATTCATACAGGACAAAAACCTGATGAATGTAGTCAATGTTGTAAAGACTGTGGATGTTACAATAGTCTCCAGATACATAAAAGA

CCACATACTGGAGAGAAATACTTTGAGTGTAACCAATGTGGTAAAGGCTTTTCACAAAACTGTTATCTTGAAATACATAAAAGAGCACATACTGTAGAGA

AACACTATTAGTGTAACAATGTGGTAAAGCTTTTGCATATCATGGCCGTCTTTGAATACATAAAGTACCATATACTGCAGAGAAACCCTATGAATGTAAT

CAATATGGTAAAGCCTTTGCATGTCAGACATGTTCAAAGGCATGAAAGAAACCATACTGTAGAGAAATCCTGTGAGTGTATTTAATATGGTGAAGCCTTT

GCACATTTCTATAGTCTTCATCATCATGAAAAAAAATCCATACTGGATAGAAACCCTATGAATGTATTTAATGTGCTAAAGCCTTTTCACATTTCATAAG

TCTTCATCATTGTGAAATAATTCATACCAGAGAGAAATGAATATATTTAATATGGAGAAGTCTTTGTGTATTTTAATAGTCTTTATTCTCGGGAAACTAT

TCATACTGGAGAGAAATTCTGTGAGTGGGAGCCTTTGTTTTATGGGGTCCGTTGAGATCCAACAAAACTCAAACTCAGGTAATGCAAGTGACAAGAACTT

ACTGTACTCAAGCTGCTACTGATAGCTCAGGGCTACAGAACATACTTGGAAACTGAACTGTGACATGCTGCCGAACCACTTCCCGACCCAGAGCAGGAGT

GGTACAGAGCTTTTAAGTTCCAAAACCAGAAATATCTGTGCCAAGTTATAGCTCCATTTTTTTTTTTCACCAGGATTTAGGGATCAGGGCTTTCCTTATC

TAGTTGATCTATGTTTACTGAAACAGTTTAACTAATCATATCCATTTATTGTTTTGTGATTAGGAACAGGCATTATGTTTTGAGGAACAAAAGATAAATA

ACAGAAGCCATGGTTAGAGACAGTCAATATGATTTCGTGAACAAAGATGGACAATAGAAGCTGGCCTGCTATTGGGAAGGTCCCAGCTACTGCAGGGCCA

GGGAACTTGAATTAGGTGTACCATATGATTAAATGGAGGCTGATAACAAAAAAAAAAAAAAAAAAAAAAAAAATGGCGTACTTAGGACAAGTTTCTTTTA

CTTGTTTCCAACAGTTGCATATCACAGGCATTTTTGAATACTTGAAAGAATAACAACATTGTAGTGAAACTTCAAATTGTTATCAATGTGATAAAGCTGT

TTTACAACACAGTTATATACATTAGAGAACACATACTGGAGAGAAATCCTATGAAGATGCAATGTGGTAAATCCTTTGTGTGTAGTGCAGTAATCTTTAA

GGACCTTAAAGAACTGATACTGAAAAGAATCTGTGACTAAAGGATTTGATGAGGTCTGTAGCCAGCACCCTTGCATTCAGTGCCAGGTGTAACATGGCTG

TGAATATGACTGCACAGCAGTTTCAGCTGTGGGAGCACCTTCAATCCGAATCACGTACCTCTGGCTTTCTAGTATACAGATGCCATTGCTCTCATCTGCT

TGTCTGCCATTGCATTTTTCTATACTATATTTGTCCTCAAATACAAGTCTGGTAAAAAATTTCTGGGAAAAGGATTGACTAGAGAAGGAAATGGCTCTGA

TATCTATTAGGAACAAACTGTTCTAGCCCTGGCTATTCAAGCAGTCAGCTCAGGCATAATGGCCCAAGGGGTTCTATGGAGATTGACTGACTTAATTGTT

CTATGAGACATTTTTGCCAAGTCATAAGGAAATATTTGAAGCAGGAAATGTTTTTGAGAAACTTGAAGTTTTAATAGTTAAATGAAGACCCCCCCCCTCC

CCCAAGGAAAAGGAACATGGGGCTTGGGTCACTAAGAGCAGGGATGGCTATAGAAAACACAATGAACAAGATAGAGGAAGAAATAGCTGGGTCTACTGGT

TAAGGAAGCAATGGTGAGAGTCCCCATGAGAGGAGATCTCTGATAATAGGTTTCATTTAGAAATATTATTGGGGAAAATTGGAAGATATATAGTACAAAA

TATAAAAGGATGGGTATAAGTGTTTAGACCCCACAAGTATTGAACAATACTAGGTTACTATTGAACAAGACTAACTCAGTTACTGGTCCTGCCAGAACTG

CTTCTATTACATATAGTCAGCTGCTCTTTGTTTTTAAATTAACTTGCTTATTTATTTAAGCTGTTACTATCAATCACTGCCATTTAGCATACAAAATCAG

GTCTAAGAAATTTCTGTCAGCTCACAGAAATTGGATTAGGCCATTGGATTAGTGAATTGACCTTCCTGGAAAGATTGGATCATTTAACCCTCTGGCATCG

CCTACCTAAAGGGAACTAGGGTATACATTCTAAGAGAATTTGAGCTTCTGAAGGAGCTCTTCAAGAAGCTGTAAAAGAAGTTAATATTGCATGTGGAAAA

TAATTAGAAAAACACTGTAGAAATAGATATTTGGAGGAGTTCAGTAAATTGGAGGAAGAGATTCTGCAGTTAGACAAGCTAAAAACACGAACATTATCCT

GACCTGTTTAGCACCTCTCTGTTTGCATTCTAATTCTGTAACTACAAGTTTATGCCCAGATGGTCTGTGATGTGGAGGTTCTTCTGAGAGTTAAAAGTTA

ATGGATAACTTGCTTTTGCAGACACTGAACTGTAAATTTATGTGTGCTTTGTGCTTTCTGGTGACATAGTGACGTGAGGGTTTGCAGGAAAAATAATGGA

TTTGACGAAAATAATGAAAAGTCTTTTGCTTATGTATTACTGTATAACAAGGAAGTGTGTAACCAATAAAAGACTGAGGTGAACTCAGAGAAAGAACCTT

CAAGCTGTCTCCGAGCACAGCTTCAGAACAGCAATGAGTTGCCTGTCAGTGTGCACCTGCA
Translation
MFLLDVFCVPLLGAGTSGKPRSSDM - UNI38688 - DIVTYDDVHVNFTWEEWALLDPSQKDLYRDVMLETYRNLAAIG - UNI38688 - GMKE

VILKRNFLNLLNMIKTLHIRAILKGMKEFILERNPMKVSNILKTLHITVVSKYREEHML

For any suggestions or comments, please send an email to unitrap@crg.es