Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000068218 (Ssxb9)
Chromosomal location
Chr X: 7944104 - 7999284 (+)
Description
synovial sarcoma, X member B, breakpoint 9 Gene [Source:MGI (curated);Acc:Ssxb9-001]
Human Ortholog
not available
Omim not available
UniTrap UNI35923
Vector Insertion
Chr X: 7952517 - 7999106
Public Clones IST12744A12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000096511
Sequence
CAGTTTCCTGAGGAATTCAAAGGGTTTGGCTGCCCTGGTTGCTGAGTCTCTAGCAACAGCTGAATCAAGGTGCATATTTGGGTCTCTTCTTGGATAAACA

CTTCTTTGTCCCTTCCTGTCTGAG GACATTTGGTTTTATGCTTGAAGAAGATAAGATTGTGTCTTTTCAAAATCACACTGACATGGAAACAGTGAGTTC

CTGTGAAAAGGTCCCCATGGAAGTGCTTTATGAACCAAAGAATATCTGCAAG GCCTTCCAGGATATTTCTACATACTTCTCTGATGAAGAGTGGGGAAA

GCTGACTCAATGGCAGAAAAGTGCCTACGTGTACATGAAAAGAAACTACATCAGAATGACTGACCTAG GGGTCACCGTGAACCAACCAGTTTTCATGCG

TGGCAAGGAGCAGGACAAGCAATCCCTGGTCGAAGGCATTGAAGATCATGACAGTGATG ATGAATGCTTTGAAGGATCTTTTGGTGTGACACCGAGAAA

ACGAATGAAG CTGACATCAGTGACAATAAGTATTCATAATGTAGAAGGAAGCCTTGCCTCTGTAAAGAATGATTCCAACTTGGCAG AAACTAGTGGCA

TTCGGGTCAATGTTTGGAGCCACCGGCTGCGAGAGAGGAAGTATCGAGTGATATATGAAGAGATTAGTGATCCTGAAGAGGAAGAAGATGATGATTACTG

AACTG - UNI35923 - ACAGTCTAAATGAGCCCACAGTGGAAGAAGGATGGAGTGGCGACTCAACATCACAGCTACAGCTTTGAAAGACTAAATATC

AGCACTATAGATACATACATTTATTTATATATTTATTGATGATATACACTTATACCTATATTCATTTATTTATAAAAGTCTACTGGAATTCTGAGTT
Translation
 METVSSCEKVPMEVLYEPKNICK AFQDISTYFSDEEWGKLTQWQKSAYVYMKRNYIRMTDLG GVTVNQPVFMRGKEQDKQSLVEGIEDHDSDD DEC

FEGSFGVTPRKRMK LTSVTISIHNVEGSLASVKNDSNLAE ETSGIRVNVWSHRLRERKYRVIYEEISDPEEEEDDDY - UNI35923 - 
Transcript ENSMUST00000115584
Sequence
CAGTTTCCTGAGGAATTCAAAGGGTTTGGCTGCCCTGGTTGCTGAGTCTCTAGCAACAGCTGAATCAAGGTGCATATTTGGGTCTCTTCTTGGATAAACA

CTTCTTTGTCCCTTCCTGTCTGAG GACATTTGGTTTTATGCTTGAAGAAGATAAGATTGTGTCTTTTCAAAATCACACTGACATGGAAACAGTGAGTTC

CTGTGAAAAGGTCCCCATGGAAGTGCTTTATGAACCAAAGAATATCTGCAAG GCCTTCCAGGATATTTCTACATACTTCTCTGATGAAGAGTGGGGAAA

GCTGACTCAATGGCAGAAAAGTGCCTACGTGTACATGAAAAGAAACTACATCAGAATGACTGACCTAG GGGTCACCGTGAACCAACCAGTTTTCATGCG

TGGCAAGGAGCAGGACAAGCAATCCCTGGTCGAAGGCATTGAAGATCATGACAGTGATG ATGAATGCTTTGAAGGATCTTTTGGTGTGACACCGAGAAA

ACGAATGAAG CTGACATCAGTGACAATAAGTATTCATAATGTAGAAGGAAGCCTTGCCTCTGTAAAGAATGATTCCAACTTGGCAG AAACTAGTGGCA

TTCGGGTCAATGTTTGGAGCCACCGGCTGCGAGAGAGGAAGTATCGAGTGATATATGAAGAGATTAGTGATCCTGAAGAGGAAGAAGATGATGATTACTG

AACTG ACAGTTGAAATAAGGCCACGGTGGAAGAAGGATGGAGTGGCAATTCAACATTACAGCTCCAGCTTTGAAAGACTAAATATCAGCAGTATAGATA

CATACATTTATTTATATATTTATTGATTATATACATTTATACCTATATTTATTTATTTATAAAAGTCTACTAGAATTCTGAGTTAA
Translation
 MLEEDKIVSFQNHTDMETVSSCEKVPMEVLYEPKNICK AFQDISTYFSDEEWGKLTQWQKSAYVYMKRNYIRMTDLG GVTVNQPVFMRGKEQDKQSL

VEGIEDHDSDD DECFEGSFGVTPRKRMK LTSVTISIHNVEGSLASVKNDSNLAE ETSGIRVNVWSHRLRERKYRVIYEEISDPEEEEDDDY 
Transcript ENSMUST00000101693
Sequence
CAGTTTCCTGAGGAATTCAAAGGGTTTGGCTGCCCTGGTTGCTGAGTCTCTAGCAACAGCTGAATCAAGGTGCATATTTGGGTCTCTTCTTGGATAAACA

CTTCTTTGTCCCTTCCTGTCTGAG GACATTTGGTTTTATGCTTGAAGAAGATAAGATTGTGTCTTTTCAAAATCACACTGACATGGAAACAGTGAGTTC

CTGTGAAAAGGTCCCCATGGAAGTGCTTTATGAACCAAAGAATATCTGCAAG GCCTTCCAGGATATTTCTACATACTTCTCTGATGAAGAGTGGGGAAA

GCTGACTCAATGGCAGAAAAGTGCCTACGTGTACATGAAAAGAAACTACATCAGAATGACTGACCTAG GGGTCACCGTGAACCAACCAGTTTTCATGCG

TGGCAAGGAGCAGGACAAGCAATCCCTGGTCGAAGGCATTGAAGATCATGACAGTGATG ATGAATGCTTTGAAGGATCTTTTGGTGTGACACCGAGAAA

ACGAATGAAG CTGACATCAGTGACAATAAGTATTCATAATGTAGAAGGAAGCCTTGCCTCTGTAAAGAATGATTCCAACTTGGCAG AAACTAGTGGCA

TTCGGGTCAATGTTTGGAGCCACCGGCTGCGAGAGAGGAAGTATCGAGTGATATATGAAGAGATTAGTGATCCTGAAGAGGAAGAAGATGATGATTACTG

AACTG - UNI35923 - ACAGTCTAAATGAGCCCACAGTGGAAGAAGGATGGAGTGGCGACTCAACATCACAGCTACAGCTTTGAAAGACTAAATATC

AGCACTATAGATACATACATTTATTTATATATTTATTGATGATATACACTTATACCTATATTCATTTATTTATAAAAGTCTACTGGAATTCTGAGTT
Translation
 MLEEDKIVSFQNHTDMETVSSCEKVPMEVLYEPKNICK AFQDISTYFSDEEWGKLTQWQKSAYVYMKRNYIRMTDLG GVTVNQPVFMRGKEQDKQSL

VEGIEDHDSDD DECFEGSFGVTPRKRMK LTSVTISIHNVEGSLASVKNDSNLAE ETSGIRVNVWSHRLRERKYRVIYEEISDPEEEEDDDY - UNI

35923 - 

For any suggestions or comments, please send an email to unitrap@crg.es