Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000068394 (Cep152)
Chromosomal location
Chr 2: 125388824 - 125450849 (-)
Description
centrosomal protein 152 Gene [Source:MGI (curated);Acc:Cep152-001]
RefSeq_dna
NM_001081091 
RefSeq_peptide
NP_001074560.1 
MGI
MGI:2139083 
Uniprot/SPTREMBL
A2AUM9 Q69ZV8 Q8R0X1 
Human Ortholog
ENSG00000103995 (CEP152)
Omim not available
UniTrap UNI6237
Vector Insertion
Chr 2: 125447003 - 125450611
Public Clones (sanger) CSG452 (baygenomics) Ayu21-120 (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12301
Vector Insertion
Chr 2: 125440168 - 125444108
Public Clones F15228 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29754
Vector Insertion
Chr 2: 125402449 - 125405761
Public Clones E082E08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11762
Vector Insertion
Chr 2: 125397570 - 125402449
Public Clones A054B06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000089776
Sequence
GCGGGCTAGGGTGTAACCGGGAAGGTGCTCGCGGCTGGAAGTCAGGGCAGCGGGTTGCGGGTTGCGGGAGGTGACTGCGGTCTCCCGGCCAGGCTGGCGG

CTGCGGGATCGGGACCCGCGTTCGAGTCTCCTACACCGGGGCTGTGCTTGCTGGCTCCCTTCTCGATCTTCAGCCTGGGCGTCCCATCGGCAGACCTGTG

CGCGCCCGTGGTTCTTGGACCCCGGGCCCAGTTCTTTG - UNI6237 - GAGGACCATGTCATTGGAGTTTGGCAGTGTAGCACTGCAGACACAAAAT

GAAGATGAAGAATTTGACAAAGAAGACTTTGAAAGGGAAAAAGAG TTGCAGCAGCTACTCACAGACCTCCCTCACGACATGCTGGACGATGAGCTCTCC

TCTCCTGAGCGCCACGATTCTGACTGCAGTATGGACGGCAGAGCGGCAGA ACCGCATCCTTCTGAGCATCTGGAAAGGAAGTGGATTGAGCGGGATATA

CTGCCCAAGCCTCACAGCATGAAC TGTGGCAATGGCTGGGAAGAAAATCGAAGTAAAACCGAAGACCAGCATCTTGGGTACCACCCTGGAGAAGGTGGG

GATGAAGGCGGAAGTGGCTATAGCCCTCCAGGTAAACGGGAGCAGGCAGATTTGTATCGCCTTCCTGAAGACTTTAGGCCATACACCGGCGGTTCGAAGC

AGGCAGCCAGCGTGATTACGTTTTCAGATCCTCAGAGGGACAATTTTCAG CAATTTGGTTTATCTCGAGGACCCAGCTGTGGAGCTTTGGAGCCGTATA

AAGCTGTATATAAGCCTTACCGTAACTCCTCTGTGCAGAAGAACAGCTCGCCAGCCCAGGAGGTAGCAGCAAGTGACATGTTTGAAGGCTTGCAGCAACA

GTTTTTAGGAGCTAATGAAA - UNI12301 - CAGACTCTGCAGAAAATATACATATTATTCAACTCCAGGTTCTTAACAAAGCAAAGGAGAGACAAC

TGGACAGCTTGGTTGAAAAGCTGAAGGACAGCGAACGCCAGGTTCGGTATCTGAGCCACCAGCTGCTGATAGTCCAAG ATGAAAAGGATGGCTTGGCCC

TCAGCCTTCGGGAATCCCAGCAGCTCTTTCAGAATGGCAAGGAGAGGGAGATGCAGCTTGAAGCTCAGATTGCAGCACTGGAGGCGCAGGTCGAGGCCTT

CCGAGTTAGTGAAGAGAAG CTCACCAAGAAGCTCAGAACAACCGAGATCACCCTGGAAAGCCTGAAACAGCAACTGGTGGAGCTCCATCATTCTGAGTC

ACTTCAGCGAGCCAGAGAGCACCATGAAAGCATCGTTGCCAGCCTCACACAGAAGCACGAAGAGCAGGTGTCATCCTTACAGAAGAATTTGGACGCTACC

ATAACGGCCCTTCAGGAACAG GAAAGTATTTGCACGCGTTTGAAGGACCACGTGCAACAACTGGAGCGGAACCAGGAAGCAGTCAGATTAGAGAAGACG

GAGCTCATTAATAGGCTGACGAGGAGTCTAGAGGACAGTCAGAAGCAATGTGCCCACCTGCTGCAATCAG GCTCTGTGCAGGAGGTGGCTCAGCTACAG

CTACAGTTGCAGCAAGCACAGAAGGCCCACGTCCTAAGTGAGAGCATGAATAAGGCTTTGCAA GAGGAATTAACAGAGCTTAAAGATGAGATTTCGCTC

TATGAATCTGCTGCAGAACTCGGAGTCCTTCCAGGTGACTCCGAAGGAGACCTGAGTATAGAGCTCACTGAATCATGTGTGGACTTGGGCATTAAAAAAG

TCAATTGGAAACAATCCAAAGCTAACAG GGTCACACAGCAGGAGTCCCCAGATGAAGACCCTTCGAAGGATGAGCTTATCCTGAAGCTGAAAACGCAAG

TCCAGCGCTTGCTGACTAGCAACTCCGTGAAGCGACATCTGGTGTCTCAGCTGCAGAGCGATCTCAGAGAGTGCCGGGAGACAATGGAAGCTTTCCAGCA

ATCCAAGGATGGTGACAGCGGCATGGAG ACTAAAACAGACACCTCTGAAAAAACAACTAAGCAGTTATGGCTCGAATCTTCTGAGGCAATTAACAGAGA

AGATATTCTGCAACTGAAAAATGAAGTTCAAGTTTTACAAAAACAGAATCAG GAACTGAAAGAGGCTGAAGAAAAACTGAGAAGTACAAATCAAGACTT

GTGTAATCAGATGAGACAGATGGTGCAGGAGTTTGACCACGATAAGCAGGAAGCTGTGGCTAG GTGTGAGAGGACTTACCAGCAGCACCACGAAGCCAT

GAAGGCGCAGATCCGAGAGAGCCTTCTAGCAAAGCACGCTGTGGAGAAGCAGCATCTCTTGGAGGTCTATGAGGGGACCCAGTCACAGCTCAG GTCTGA

CCTGGATAAGATGAACAAGGAGATGGCTGCTGTGCAGGAGTGTTACCTGGAGGTATGCAGAGAGAAGGATGGGCTGGAGTCCACTCTCAGGAAGACCATG

GAAAAGGCTCAGGAGCAGAAG AGACAGCTTTTGGAAGCCAGAGAAGAATACGTGCGCAAGCTGAAGTTAGAACTGGAAGAGAAGTACCAAGAAACTCTG

AAGACGGAAAGGCAGAGCTGGCTGCAGGAGCAAGCTGCTGGAGCTACACAGCAGGCTGAGAAGGAG AGCAGACAAAAACTCATTCAACAGCTGGAAAAG

GAGTGGCAGTCCAAACTGGATGACAGTCTTGCGGCTTGGAGAAAGACCACCTCAGACCGCGGCAGCCAGACCGAGCAGGTGGCCTGTCCTGCTGCCGTGT

CTAAGGCAGAGGCAGCAGCAGTCCTGGCAGAGGAGCAGGCTCGCCAAGTCCAGCAGGAGAAGGAGCTTGCTACCAAGGAGGCTCTGAGGAAGCCCGAAGT

TGAGTTGGAGCTCAAGTACTGTGAGATTATTGCACAAAAG GTGGAAACAGCTGTGCAGAATGCCCGAAGTCGCTGGATACAGGAGCTGCCCATGCTTGC

AGAGTACAAGGCTCTGCTCAGAGCCCAGCAGCAGGAGTGGGCAAAGCAGCAGGAGCTGGCTGTGGCCCATAGG - UNI29754 - CTGTCACTCGCAC

TCTCTGAAGCTAAAGAGAAGTGGAAAAGTGAGCTGGAAAATATGAAGCCAAATGTCATGTCTGTCAAGGAGCTGGAGGAGAAAGTCCACTCTCTGCAGAA

GGAGCTGGAGTTGAAGGATGAGGAAGTCCCAGTGATTGTCAGAGCTGAGGTGGCTAAGGCCAGAACTGAGTGGAACAAAGAAAAACAGGAAGAAATCCAC

AAGATTCAAGAACAAAACGAGGAGGATTATCGGCAGTTTTTAGAGGATCATCGAAATAAAATTAATGAGGTGCTTGCAGCAGCTAAAGAGGACTTTGTGA

AGCAAAAAGCTGAACTACTTCTTCAGAAGGAGACAGAATTCCAGGCATGTTTGGACCAGAGTCGCAAGGAGTGGACACTGCAGGAAGCCCAGCAGACACA

AGTGGAAATCCGTCAGTATGAGGAAGACACCCTCACTGTACTTGCCTATCTTCTAAAGGACACGCAGCTGGAGTACGGTGGGGACTCACAGGACAAGCAG

CTTTTGGAAGCCATGTCAGCTTGTTCTTCCAAATGGATATCTGTACAGTACTTTGAGAAAGTAAAAGCCTGCATACAAAAAGCTCTTCACGATATGCTGT

CCTTGCTTACAGACAGTGTCGCCTCAGAGCAGGAGAAG - UNI29754 - AGAAAGGTGGTCAAGAGCTCTGCAGACACTGTCAGCTGGACCAGTAGC

GAAGGAGACTCTGCGGTCCCAGTGCCCCTTCCTGACTCCACCTCTGTACGCTGTGCTCAGTCCTCGGCCTGGCTGAAAGCAGAAGCAGAAACTG - UNI

11762 - - UNI29754 - ATAAAAAGATCTGTGAAATTAAAGGTTTACGCTGTGGACACTGCTTTCAAGAGCTTGAAAAGGAAAAGCAGGAGTGTCA

AGATCTGAGAAGGAAACTGGAGAAGTGCCGTAGGCACCTTCAGCATTTAGAAAGGACACACAGAGCCGCAGTGGAGAAACTTGGAG AGGAGAACAGCAG

GGTGGTTGAAGAATTAATAGAGGAGAACCATGACATGAAGAATAAACTGGAGGCACTGAGGGCCCTTTGCAGAACGCCACCACG GTCACTGTCTGCAGG

AGCCGCTGAGAGTGCTGGGCCGTCATGCAGTAGGCAGGCCTTGGAAGAACTCCGCGGGCAGTACATTAAAGCTGTGAGAAAAATTAAAC GTGACATGCT

TCGGTATATTCAGGAGAGCAAGGAAAGAGCTGCAGAGATGGTAAAAGCGGAAGTGTTGCGGGAACGGCAGGAAACTGCACGGAAGATGCGCAATTATTAC

CTGAGTTGTCTTCAGCAGATCTTGCAGGATAATGGAAAAGAGGAGGG AGCTGAGAAAAAGATTATGAGTGCTGCTAGCAAACTCGCTACAATGGCGGAG

TTGCTGGGGACGATCGCGGAGTCAGACTGCAGAGTCCGGTGTGCCCAGGCAGGCCGCTCAG TAGCACTTCCTTTGGCTTCAGAGATGCTGACGGGCACT

GAAAGATCAGAAAGGAGTGGTGTGAATCACAATATTCCACATTACGTTGAAAGCAAACCAAACAGTGGAAAGACCCTCCCCAGGAGTGTGTGTGAGCAGC

TGCCTGGGAGGAAGGCTGCGCCCAGGTCACAGAGGCGGTTAGAGGAATCGAAGCACAGAGAGATGAGACCCATGGCTTCCACAGCTTTGCCTTCAGACTG

TCGCTGTGGGGATGCGAGTTGCAGGCACTCAGGCGTCTTGGCAAAGGATGTTGCTCCTGAATTTGTTCCGTGCCAGGGCGAGGGAGGCTTTGACTTGCAC

GAGAAGAGAGATGCACTTGGAGCTGGCTCTGAGCCGCTGCTCTATTCAGCTGCTCACTCCTTCCTTGGAGGTGCCGAAAAGAACTCTTCTCCTAGATGCA

TCTCAGAGTCCAGGCACACAACCCTGAGAAGTCCCAGTGAAATGCCAAGGTTAAAGGCATTGATGTGTGGTTCTCCTACAGAAACTGACAGTATTGCATC

TGAGAAGAGTCAGGGAGTGGGCTCTCAGGACTCCCCAGTGAAGGATGGCGTGGGGCCCAGCAGCTCTCCAGCCTGGCCTTCTGACAGTACCTTACCCTGT

GGCAGTCCTGCAGTGCTGTTTCTTGGGGATGGGTCACAAAGGACTCAGGAGATGCTGGGGGACTCTGTTCAGTGGAAACAATTCTCAGCAACCAGTTGTC

ATCCAGATGCCCAGAAAAGTAATATGGTTTGTCGGAGTAGTCACACTCTAGATCTGCCCAAAGAAACCCTGCATTCCCAACAAGGGAAGATGGGTGCAAC

TCTGGGACACCCATCTCCACAGAGCACTGATATGTTAAAGACAGATTTCAAGAGACTCAGTGGCACAGGACCATCTTCATTGTGTCAGAAGCCTTTGATA

AAGTTAACTGCTCCGATGCCCAGCCAACAGGATAGTGGCTTTGACAGCCCGCTTGAGTAATTATTTGCCTTATTTCAGAATAGTCATTAATTACTATTTA

AACAGGAAACTGGATGGTAATACTTGATGCTAACAAACCATTGTGAGGTCTTCCTGCCAGTTCTCATGTTTTTGATACCCTTGTATCTGAGTAAAGTATT

CTCAGTTACTTGAGGCACTTGCGCTGCCTTAATGTTGGAGGCCTAAGTGATGTGCTGTGTGCTCTGCTTCTGTGTGCTGCTTCATTCAGTTACTCAGCCC

TCTACCTTTATATTTATATGCTGACTTATTTTGGAGTGTTAAAATATTTAATAAAATTGTGCATAATCCGAA
Translation
 - UNI6237 - MSLEFGSVALQTQNEDEEFDKEDFEREKE LQQLLTDLPHDMLDDELSSPERHDSDCSMDGRAAE EPHPSEHLERKWIERDILPKP

HSMN CGNGWEENRSKTEDQHLGYHPGEGGDEGGSGYSPPGKREQADLYRLPEDFRPYTGGSKQAASVITFSDPQRDNFQ QFGLSRGPSCGALEPYKAV

YKPYRNSSVQKNSSPAQEVAASDMFEGLQQQFLGANET - UNI12301 - TDSAENIHIIQLQVLNKAKERQLDSLVEKLKDSERQVRYLSHQLLIVQ

D DEKDGLALSLRESQQLFQNGKEREMQLEAQIAALEAQVEAFRVSEEK LTKKLRTTEITLESLKQQLVELHHSESLQRAREHHESIVASLTQKHEEQV

SSLQKNLDATITALQEQ ESICTRLKDHVQQLERNQEAVRLEKTELINRLTRSLEDSQKQCAHLLQSG GSVQEVAQLQLQLQQAQKAHVLSESMNKALQ

 EELTELKDEISLYESAAELGVLPGDSEGDLSIELTESCVDLGIKKVNWKQSKANR RVTQQESPDEDPSKDELILKLKTQVQRLLTSNSVKRHLVSQLQ

SDLRECRETMEAFQQSKDGDSGME TKTDTSEKTTKQLWLESSEAINREDILQLKNEVQVLQKQNQ ELKEAEEKLRSTNQDLCNQMRQMVQEFDHDKQE

AVAR RCERTYQQHHEAMKAQIRESLLAKHAVEKQHLLEVYEGTQSQLR RSDLDKMNKEMAAVQECYLEVCREKDGLESTLRKTMEKAQEQK RQLLEA

REEYVRKLKLELEEKYQETLKTERQSWLQEQAAGATQQAEKE SRQKLIQQLEKEWQSKLDDSLAAWRKTTSDRGSQTEQVACPAAVSKAEAAAVLAEEQ

ARQVQQEKELATKEALRKPEVELELKYCEIIAQK VETAVQNARSRWIQELPMLAEYKALLRAQQQEWAKQQELAVAHR - UNI29754 - LSLALSE

AKEKWKSELENMKPNVMSVKELEEKVHSLQKELELKDEEVPVIVRAEVAKARTEWNKEKQEEIHKIQEQNEEDYRQFLEDHRNKINEVLAAAKEDFVKQK

AELLLQKETEFQACLDQSRKEWTLQEAQQTQVEIRQYEEDTLTVLAYLLKDTQLEYGGDSQDKQLLEAMSACSSKWISVQYFEKVKACIQKALHDMLSLL

TDSVASEQEK - UNI29754 - RKVVKSSADTVSWTSSEGDSAVPVPLPDSTSVRCAQSSAWLKAEAETD - UNI11762 - - UNI29754 - D

KKICEIKGLRCGHCFQELEKEKQECQDLRRKLEKCRRHLQHLERTHRAAVEKLGE EENSRVVEELIEENHDMKNKLEALRALCRTPPR RSLSAGAAES

AGPSCSRQALEELRGQYIKAVRKIKR RDMLRYIQESKERAAEMVKAEVLRERQETARKMRNYYLSCLQQILQDNGKEEG GAEKKIMSAASKLATMAEL

LGTIAESDCRVRCAQAGRSV VALPLASEMLTGTERSERSGVNHNIPHYVESKPNSGKTLPRSVCEQLPGRKAAPRSQRRLEESKHREMRPMASTALPSD

CRCGDASCRHSGVLAKDVAPEFVPCQGEGGFDLHEKRDALGAGSEPLLYSAAHSFLGGAEKNSSPRCISESRHTTLRSPSEMPRLKALMCGSPTETDSIA

SEKSQGVGSQDSPVKDGVGPSSSPAWPSDSTLPCGSPAVLFLGDGSQRTQEMLGDSVQWKQFSATSCHPDAQKSNMVCRSSHTLDLPKETLHSQQGKMGA

TLGHPSPQSTDMLKTDFKRLSGTGPSSLCQKPLIKLTAPMPSQQDSGFDSPLE

For any suggestions or comments, please send an email to unitrap@crg.es