Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000068457 (Uty)
Chromosomal location
Chr Y: 433587 - 582181 (-)
Description
ubiquitously transcribed tetratricopeptide repeat gene, Y chromosome Gene [Source:MGI Symbol;Acc:MGI:894810]
RefSeq_dna
NM_009484 
RefSeq_peptide
NP_033510.2 
UniGene
Mm.422197 
MGI
MGI:894810 
Uniprot/SWISSPROT
P79457 
Uniprot/SPTREMBL
Q8C926 Q3TNX2 Q3UQE8 Q5DTQ7 
Human Ortholog
ENSG00000183878 (UTY)
Omim not available
UniTrap UNI31549
Vector Insertion
Chr Y: 581598 - 582182
Public Clones IST10110D12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23633
Vector Insertion
Chr Y: 576263 - 581598
Public Clones IST10332D12 (tigm) IST10110D12 (tigm)
Private Clones OST250953 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10464
Vector Insertion
Chr Y: 560990 - 576153
Public Clones D054F08 (ggtc) (ggtc) IST12212H8HMR1 (tigm) IST13682G9 (tigm) IST14541A4 (tigm)
IST10409F5 (tigm) IST10294C5 (tigm) IST12685B11 (tigm) IST10387E8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2559
Vector Insertion
Chr Y: 535957 - 560939
Public Clones (sanger) XS0378 (sanger) IST11384E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33420
Vector Insertion
Chr Y: 523216 - 525834
Public Clones IST14465B10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30745
Vector Insertion
Chr Y: 512933 - 523252
Public Clones IST14671H6 (tigm) IST11553H10 (tigm) IST11529G1 (tigm) IST14610C6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23521
Vector Insertion
Chr Y: 495078 - 504532
Public Clones not available
Private Clones OST254944 (lexicon)
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19635
Vector Insertion
Chr Y: 489318 - 490597
Public Clones not available
Private Clones OST385719 (lexicon)
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34047
Vector Insertion
Chr Y: 474249 - 488597
Public Clones IST12841A1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32306
Vector Insertion
Chr Y: 471314 - 473440
Public Clones IST10286D5 (tigm) IST14790H12 (tigm) IST12295G3 (tigm) IST10382C11 (tigm)
IST12875D3 (tigm) IST13360G2 (tigm) IST10609D10 (tigm) IST13054C6 (tigm)
IST14446A3 (tigm) IST14675F8 (tigm) IST10851G5 (tigm) IST11054C2 (tigm)
IST13934E4 (tigm) IST12058G2 (tigm) IST11552A9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38037
Vector Insertion
Chr Y: 439207 - 466455
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000044500
Sequence
GAGAGGTTATGGACGTTACGTGCGGTTCACACTGACGGTATTATAACAACTTTATGCGGATGCTAGCGAAGTTTGATATTCTAAGAACTTCGCTTAGGTT

CTGCAACAATGAGTTCTTCTTGCGTTCACCATCTGCGTGGTAATGTGACCAGATAGCCTCTGCCGCTTTCTCCTTTGCCAGTTTCCATGAAATCTTACGG

ATTATCTCTCACTACTGCTGCCCTAGGTAATGAGGAAAAGAAAATGGCGGCGGAAAAGGCTAGAGGCGAGGGCGAAGAGGGGTCCTTCAGTCTCACAGTC

GAAGAGAAGAAGGCGCTTTGTGGATTAGATAG - UNI31549 - CAGCTTCTTCGGGTTCTTGACCCGATGCAAAGATGGCGCCAAGATGAAGACGCT

GTTGAACAAG - UNI23633 - - UNI31549 - GCAATTCACTTCTATGAGTCTTTAATAGTAAAAGCTGAAGGAAAAGTGGAATCAGATTTCTTT

TGTCAATTAGGTCACTTCAATCTCTTACTGGAAGATTATTCAAAAG - UNI10464 - CATTGTCATCTTACCAGAGATACTACAGTTTACAGACTGA

CTACTGGAAG - UNI2559 - - UNI33420 - CATTTTCAGCTGGCCCTGATCGACTGTAATGTCTGTACTTTGTCCAGTGTCGAAA - UNI307

44 - - UNI33420 - TTCAGTTTCATATTGCTCACTTATATGAAACCCAG - UNI30744 - - UNI33420 - AGGAAATACCATTCTGCAAA

GGCAGCCTATGAACAACTTTTACAGATTGAAAGCTTGCCATCACAAGTCAAAGCAACTGTATTGCAACAGTTAG - UNI30744 - GTTGGATGCACC

ATAATATGGATCTAATTGGAGACAATACCACCAAAGAGAGATATGCTATTCAGTATCTCCAAAAGTCATTGGAGGAAGATCCTAATTCTGGTCAATCTTG

GTATTTCCTTGGAAG GGAAAGTGCTCAGAGGTCAGACCTGCCTCCTGGCTGA
Translation
MKSYGLSLTTAALGNEEKKMAAEKARGEGEEGSFSLTVEEKKALCGLDS - UNI31549 - SSFFGFLTRCKDGAKMKTLLNK - UNI23633 - -

 UNI31549 - AIHFYESLIVKAEGKVESDFFCQLGHFNLLLEDYSKA - UNI10464 - ALSSYQRYYSLQTDYWK - UNI2559 - - UNI33

420 - HFQLALIDCNVCTLSSVEI - UNI30744 - - UNI33420 - IQFHIAHLYETQ - UNI30744 - - UNI33420 - RKYHSAKAA

YEQLLQIESLPSQVKATVLQQLG - UNI30744 - GWMHHNMDLIGDNTTKERYAIQYLQKSLEEDPNSGQSWYFLGR RESAQRSDLPPG
Transcript ENSMUST00000069309
Sequence
GAGAGGTTATGGACGTTACGTGCGGTTCACACTGACGGTATTATAACAACTTTATGCGGATGCTAGCGAAGTTTGATATTCTAAGAACTTCGCTTAGGTT

CTGCAACAATGAGTTCTTCTTGCGTTCACCATCTGCGTGGTAATGTGACCAGATAGCCTCTGCCGCTTTCTCCTTTGCCAGTTTCCATGAAATCTTACGG

ATTATCTCTCACTACTGCTGCCCTAGGTAATGAGGAAAAGAAAATGGCGGCGGAAAAGGCTAGAGGCGAGGGCGAAGAGGGGTCCTTCAGTCTCACAGTC

GAAGAGAAGAAGGCGCTTTGTGGATTAGATAG - UNI31549 - CAGCTTCTTCGGGTTCTTGACCCGATGCAAAGATGGCGCCAAGATGAAGACGCT

GTTGAACAAG - UNI23633 - - UNI31549 - GCAATTCACTTCTATGAGTCTTTAATAGTAAAAGCTGAAGGAAAAGTGGAATCAGATTTCTTT

TGTCAATTAGGTCACTTCAATCTCTTACTGGAAGATTATTCAAAAG - UNI10464 - CATTGTCATCTTACCAGAGATACTACAGTTTACAGACTGA

CTACTGGAAG - UNI2559 - AATGCTGCCTTTTTATATGGTCTTGGTTTGGTCTATTTCTACTACAATGCATTTCAGTG GGCAATTAGAGCTTTTC

AGGAAGTCCTTTATGTTGACCCTAATTTTTGCAGAGCCAAAGAAATCCATTTACGACTTGGTTTTATGTTCAAAATGAATACAGATTATGAATCTAGTTT

AAAG - UNI33420 - CATTTTCAGCTGGCCCTGATCGACTGTAATGTCTGTACTTTGTCCAGTGTCGAAA - UNI30744 - - UNI33420 - 

TTCAGTTTCATATTGCTCACTTATATGAAACCCAG - UNI30744 - - UNI33420 - AGGAAATACCATTCTGCAAAGGCAGCCTATGAACAACT

TTTACAGATTGAAAGCTTGCCATCACAAGTCAAAGCAACTGTATTGCAACAGTTAG - UNI30744 - GTTGGATGCACCATAATATGGATCTAATTG

GAGACAATACCACCAAAGAGAGATATGCTATTCAGTATCTCCAAAAGTCATTGGAGGAAGATCCTAATTCTGGTCAATCTTGGTATTTCCTTGGAAG GT

GTTACTCATGTATTGGGAAGGTTCAGGATGCCTTTGTATCTTACAGGCAATCCATTGATAAATCAGAAGCAAGTGCAGACACATGGTGTTCAATAGG TG

TGCTGTATCAACAGCAAAATCAACCTATGGATGCCTTGCAAGCCTATATATGTGCTGTACAGTTGGATCATGGACATGCAGCAGCCTGGATGGACTTAGG

TATTCTTTATGAATCTTGCAACCAACCCCAGGATGCCATTAAATGCTACTTAAATGCAGCTCGGAGCAAATCTTGTAATAACACCTCTGCACTTACATCA

AGAATTAAGTTTTTACAG GCTCAGTTGTGTAACCTTCCACAAAGTAGTCTACAGAATAAAACTAAATTACTTCCTAGTATTGAGGAGGCATGGAGCCTA

CCAATACCCGCAGAGCTTACCTCCAGGCAGGGTGCCATGAACACAGCACAGCAG AGTGTTTCTGATACCTGGAATAGTGTCCAGACAGCTTCACATCAT

TCAGTACAGCAGAAAGTTTATACACAGTGCTTCACAGCACAGAAATTACAG - UNI23521 - AGTTTTGGTAAAGATCAACAACCTCCATTTCAAAC

TGGGTCCACACGATATCTCCAAGCAGCTAGCACTAATGATCAGAATCAGAATGGAAATCATACTCTGCCTCAGAATTCAAAAGGGGATGCTCAAAATCAC

TTCTTACGTATTCCTACCTCAGAAGAACAAAAGATCATTAACTTTACCAAAGAGAGCAAGGATTCAAGAAGTAAATCCTTGACTTCTAAAACAAGTAGGA

AAGATAGAGACACATCTAATATCTGTGTTAATGCAAAGAAGCATTCTAATCATATTTATCAGATCTCATCAGTTCCGATTTCCAGCCTTAATAATAAAGA

ATCTGTGTCACCAGATTTAATAATTGTAGACAATCCTCAGCTTTCTGTCTTAGTTGGAGAAACTATCGACAATGTGGACCATGACATTGGAACTTGTGAC

AAAGTCAATAATGTTCATCTAGCCATTCACAAAAAGCCTGATAATCTTTCTGCTTCTTCACCCTCTTCAGCCATTTCCACAGAAACACTTTCTCTAAAGC

TCACTGAACAGACACACATTGTTACCAGCTTTATCAGTCCTCACAGTGGATTACACACAATTAATGGAGAAGGGCATGAGAACTTAGAGAGTTCTGCCAG

TGTTAATGTTGGCCTCAGACCTAGATCTCAAATCATACCATCAATGTCTGTGTCCATATACTCCAGTTCAACAGAAGTTCTGAAAGCGTGCAG GAGTCT

AGGTAAAAATGGTTTGTCTAATGGTCATATTCTCTTGGATATATGCCCACCTCCAAGACCACCAACTTCGCCATATCCTCCTTTACCAAAGGAGAAGTTG

AATCCACCCACTCCTAGTATTTAT - UNI19635 - TTGGAAAATAAGCGAGATGCCTTTTTTCCTCCATTACATCAATTTTGCATCAATCCAAAAAA

CCCTGTTACAGTAATTCGCGGTCTTGCTGGAGCTCTTAAGTTAG - UNI34047 - ATCTTGGACTTTTCTCTACCAAAACTTTGGTAGAGGCTAACA

ATGAACATATCGTAGAAGTGAGGACCCAATTGTTACAGCCAGCAGATGAAAACTGGGATCCCTCTGGAACAAAGAAAATCTGGCGATATGAAAATAAAAG

TTCTCATACTACAATTGCTAAATATGCACAGTACCAGGCCTGCTCCTTCCAGGAATCATTGAGA - UNI34047 - GAAGAAAATGAAAGAAGAACAC

AAGTTAAAGACTATTCAGATAATGAATCAACATGTTCAGATAA - UNI34047 - TTCTGGAAGGAGACAGAAAGCACCCTTTAAAACCATAAAATGT

GGGATTAACATTGATCTGTCTGATAACAAAAA - UNI32306 - GTGGAAGTTGCAGTTACATGAGCTGACAAAGCTTCCTGCTTTTGTACGTGTTGT

ATCAGCAGGGAATCTTCTCAGTCATGTTGGCTATACTATATTGGGGATGAATTCAGTTCAACTATGTATGAAAGTTCCAGGGAGTAGAATACCAG - UN

I32306 - GTCACCAAGAAAATAACAATTTCTGTTCTGTTAACATAAATATTGGTCCAGGTGATTGTGAATGGTTTGTTGTACCTGAAGATTATTGGGG

TGTTCTGAATGACTTCTGTGAAAA - UNI32306 - AAATAATTTGAATTTCCTGATGAGTTCTTGGTGGCCGAACCTTGAAGATCTTTATGAAGCAA

ATGTTCCTGTTTATAGGTTTATTCAACGACCTGGTGATTTGGTTTGGATAAATGCAGGCACTGTTCACTGGGTTCAGGCTATTGGGTGGTGTAACAACAT

CACCTGGAATGTTGGTCCACTCACAG CCTTCCAATATAAATTGGCAGTTGAACGATATGAATGGAATAAATTGCAAAGTGTCAAGTCAGTAGTACCCAT

GGTTCATCTTTCATGGAATATGGCACGAAATATCAAAGTCTCAGATCCAAAGCTTTTTGAAATGATTAA ATATTGTCTCCTCAAGATTCTAAAGCATTG

TCAGACTTTGAGAGAAGCTCTTGTTGCAGCAGGGAAAGAGGTTTTGTGGCATGGGAGGATAAATGATGAACCAGCTCCTTACTGTAGCATCTGTGAG GT

GGAAGTTTTTAATTTACTTTTTGTCACTAATGAAAGCAATTCTCAAAAGACATATATAGTACATTGTCAGAACTGTGCACGAAAAACAAGTGGAAATTTG

GAAAATTTTGTAGTGCTAGAACAATACAAAATGGAGGACCTGATTCAAGTCTATGACCAATTTACATTA GCTCCTTCGTTATCTTCTGCATCTTAATAT

TGTTCCAGAAATACTGAGGCGTTTGTTCTTCTTGAAATATACTACTTATTTTCTTGTTATTCTCATAAGACTGCTATCTCAAAGCTAAATTTATGCAACC

TTTCAAGAGTAGAGAATCAGGAGACTAAACAGAGCATTACTTCTATTCCAAGATTTACAAAGTTGACCCAAATGTATTTCATAATTAAAAGTTAATAGTA

ATAGTCACATGATTTGTATATATCTGCCAGAAATAACATTTTGACACAAACAAATACCTGGAAAACAACTTTTTATATCTCCATTTCCTGGATGACAGAT

TTCTTTATGCTTGTAAGTTACCCCAAATTTTTTGTTTAGAATCAAATAGTATCTTATTTGGCTACTTCTTTTTAAGATAACTAACAAATTGAAAAAAAAT

TTTTTCTTTTACCAATTTTTTGCTAAAGTCAAAATAATATGAAAAAGGTTTATATTGCTCTGTCACTATTGTTTTGAAGTCTTGATTTCATGTGATTACA

AAATAAAAATATTAACAGACTGGTAAAAAGATTATAGGTTGCATATAAATAATTTCAAAGTGATGGTTTTTTGTTTTGTTTTGAATCTTGACACAAACTC

AAACTATTCATAAATACATATATATATGTGTATATATGTATGTATACATATATGTACATATATATATATATACACATACATACATATATACATATATATG

TATATTGCTGGAAAATCCTTGTGAATTGAATGTTATTTTTTTCTAGATTTACTTGCCATTAAATACTAAGGAGTTGTATAATTTTAAATGCCACAATTAA

TTTTTATATGTGTAAATAAAGCTACTTAGTATTGTACATAAACTCTTATTAAAATTATTTAGTGTATAAAGAATTTTTCAATGTTTGAGTTTTGAAGATT

ATATAGTTCCAATCTTTGTTCCTTTTCAAAGTTAATGAATATATGTATTTAAGTCTGCCAACACATGTATGTATGTAGAGATCTCAGTATTTCACTCAAC

AAGAAAATCACAATTTTTCAATTTTTTATGGCTGAAAGTTTTTGAAGGTATTTGCTTACAAAATAGGTATGCTTATTTTTAAAGACCATCAGTGTCTTTT

AGTCTGATTAGGTTACACCTTATGAAATGACAAGTAGTTGCTGTCAGAAATATTTTTTAAGGGTAGAAAATAAAGGTAAATTAAGATTTTTTTATAAGAA

ACATAGATTTGACAAGTGCTTATCATTTAGAGTTTTGCTTTAATGGAAAAGTTCATTGCAATGATGATCTCTATTTTAGAGTTTAATATTCCTAGGAACT

TTTAAAACAGATAATTTTGAAATTCCATGTATTCCTGCTTGTTCAATCTGGTGTGTGTTGGGAGACTTACGCATTAAAATTTATTATTAGTAAATCTTAA

Translation
MKSYGLSLTTAALGNEEKKMAAEKARGEGEEGSFSLTVEEKKALCGLDS - UNI31549 - SSFFGFLTRCKDGAKMKTLLNK - UNI23633 - -

 UNI31549 - AIHFYESLIVKAEGKVESDFFCQLGHFNLLLEDYSKA - UNI10464 - ALSSYQRYYSLQTDYWK - UNI2559 - NAAFLYG

LGLVYFYYNAFQW WAIRAFQEVLYVDPNFCRAKEIHLRLGFMFKMNTDYESSLK - UNI33420 - HFQLALIDCNVCTLSSVEI - UNI30744 

- - UNI33420 - IQFHIAHLYETQ - UNI30744 - - UNI33420 - RKYHSAKAAYEQLLQIESLPSQVKATVLQQLG - UNI30744 - 

GWMHHNMDLIGDNTTKERYAIQYLQKSLEEDPNSGQSWYFLGR RCYSCIGKVQDAFVSYRQSIDKSEASADTWCSIG GVLYQQQNQPMDALQAYICAV

QLDHGHAAAWMDLGILYESCNQPQDAIKCYLNAARSKSCNNTSALTSRIKFLQ AQLCNLPQSSLQNKTKLLPSIEEAWSLPIPAELTSRQGAMNTAQQ 

SVSDTWNSVQTASHHSVQQKVYTQCFTAQKLQ - UNI23521 - SFGKDQQPPFQTGSTRYLQAASTNDQNQNGNHTLPQNSKGDAQNHFLRIPTSEE

QKIINFTKESKDSRSKSLTSKTSRKDRDTSNICVNAKKHSNHIYQISSVPISSLNNKESVSPDLIIVDNPQLSVLVGETIDNVDHDIGTCDKVNNVHLAI

HKKPDNLSASSPSSAISTETLSLKLTEQTHIVTSFISPHSGLHTINGEGHENLESSASVNVGLRPRSQIIPSMSVSIYSSSTEVLKACR RSLGKNGLSN

GHILLDICPPPRPPTSPYPPLPKEKLNPPTPSIY - UNI19635 - LENKRDAFFPPLHQFCINPKNPVTVIRGLAGALKLD - UNI34047 - DL

GLFSTKTLVEANNEHIVEVRTQLLQPADENWDPSGTKKIWRYENKSSHTTIAKYAQYQACSFQESLR - UNI34047 - EENERRTQVKDYSDNESTC

SDN - UNI34047 - NSGRRQKAPFKTIKCGINIDLSDNKK - UNI32306 - KWKLQLHELTKLPAFVRVVSAGNLLSHVGYTILGMNSVQLCMK

VPGSRIPG - UNI32306 - GHQENNNFCSVNINIGPGDCEWFVVPEDYWGVLNDFCEK - UNI32306 - KNNLNFLMSSWWPNLEDLYEANVPV

YRFIQRPGDLVWINAGTVHWVQAIGWCNNITWNVGPLTA AFQYKLAVERYEWNKLQSVKSVVPMVHLSWNMARNIKVSDPKLFEMIK KYCLLKILKHC

QTLREALVAAGKEVLWHGRINDEPAPYCSICE VEVFNLLFVTNESNSQKTYIVHCQNCARKTSGNLENFVVLEQYKMEDLIQVYDQFTL APSLSSAS

For any suggestions or comments, please send an email to unitrap@crg.es