Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000068580 (Zfyve19)
Chromosomal location
Chr 2: 119034761 - 119042785 (+)
Description
zinc finger, FYVE domain containing 19 Gene [Source:MGI (curated);Acc:Zfyve19-002]
RefSeq_dna
NM_028054 
RefSeq_peptide
NP_082330.1 
UniGene
Mm.386807 
MGI
MGI:1919258 
Uniprot/SWISSPROT
Q9DAZ9 
Uniprot/SPTREMBL
A2AV55 Q4KL52 
Human Ortholog
ENSG00000166140 (ZFYVE19)
Omim not available
UniTrap UNI35963
Vector Insertion
Chr 2: 119034920 - 119036217
Public Clones (ggtc) IST14582B11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5866
Vector Insertion
Chr 2: 119037036 - 119037133
Public Clones CSH950 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000090174
Sequence
CGCCGATGGGCGTGTGGGACTGGGCTGCACAACCTGAGGGTCTGAGAGGCCTACCCTGCGCTGGTGAGAGGCTAACCTACCAATTCTGCAGCGCCGAGAA

CTGCTATGGAGAGCAGGTGCTACGGCTGTGCTGTCAAGTTCACCCTCTTCAAGAAGGAG - UNI35963 - TATGGCTGTAAGAATTGTGGCCGAGCC

TTCTGTAACGGCTGTCTTAGCTTCAGCGCTCTGGTACCCCGGGCTGGCAACACACAACAGAAAGTCTGCAAGCAGTGCCACACAATCCTGACCAG AGGG

TCTTCTGACAATGCTTCCAAGTGGTCACCACCTCAGAACTATAAGAA GCGTGTGGCAGCCTTGGAAGCCAAGAAAAAGTCCAGCACTTCCCATAGCCAA

AGCCTGACCCACAAAGACCAAGCCATCGCTGAGCGCCTAGCACGGCTTCGTCAGGAAAACAAGCCTA - UNI5866 - AGTCAGTACCCTCACAAGCC

GAGATAGAGGCACGGCTAGCCGCACTGAAGGATGAAGTCCAGGGCCCCATTCCTTCCACGCAGGAGATGGAGGATCGGCTTGCAGCCTTGCAGGGCAGAG

TCCCACCTTCTCACACCGTGAGACCG GCACACCAGGCACCAGATACCAGGACCCAGGCCCAGCAGACGCAGGATCTGCTAACACAGTTGACAGCTGAGG

TGGCTATTGATGAAAACTGCCAACCAAGAGCCTCAG CCTCTCTCCAGAATGACCTCAACAAGGGAGCTGCGAGAAGCCAGCGCACAAATTCCCAGGGCC

AGGCCAGCCAGTCTCTGGAGGAAGAGAAGTACAAGCTGCTGGCTGAGGCAGCTGTTGAGCTACAGGAGGAGAACACCAGGCAGGAACGGATCCTGGCTCT

TGCCAAAAGATTGGCTGTACTGAAGGGACAGGACCCCAGCAGAG TGACCCTCCAGGACTATCACCTCCCAGACAGTGATGAGGATGAAGAGACAGCCAT

CCAGAGAGTCATGCAGCAG CTCACTGAAGAAGCTGCCCTGGATGAGGCAAGTGGCTTTAACATCCCTGAGAAACCAGCTCCAGGATCCCGGGCCCAACC

CTGCAAGGCAGAGATGGAG GGGCCCCAGGCTGAGGAGGAGGAACTCCCCTGGTGCTGTATCTGCAATGAGGATGCTACTTTGCGCTGTGCTGGCTGTGA

TGGGGACCTCTACTGTGCCCGGTGCTTCCG GGAGGGCCATGATAACTTTGATCTTAAAGAACATCAGACTTCTCCCTACCACCCCCGACGGCCTTGCCA

AGAACACTGAGGATAACCTAATGATCTCCTGAGGTGGCTGTGCCACAGGCAACCAGCAGGCTGGGAAGACTCCTGGGCCAAGTCTCAGGGCATCCAGGGG

GACAGAAGACCCTGCTCTACTGATGGTAAACACACCCTTTTGTGAGCTTCCCAGTCCCTGGAAGGAAGAAACATAATAAGTCTGAGAGGGGCCAGGTGAG

AGGAGGAGTCATGGCCCTCCCCTAAGAGGCTGGCCTCAAACAGAGACAGATGGAGAAGACACCATACTGAAGCTAAAAGTGATACCTGAAATCTGCTTCC

CAGGCCCAATCCTGGCTATACTGGGATCTAATAAAATGTGTTGAGCCATTGG
Translation
MESRCYGCAVKFTLFKKE - UNI35963 - YGCKNCGRAFCNGCLSFSALVPRAGNTQQKVCKQCHTILTR RGSSDNASKWSPPQNYKK KRVAALE

AKKKSSTSHSQSLTHKDQAIAERLARLRQENKPK - UNI5866 - KSVPSQAEIEARLAALKDEVQGPIPSTQEMEDRLAALQGRVPPSHTVRP AHQ

APDTRTQAQQTQDLLTQLTAEVAIDENCQPRASA ASLQNDLNKGAARSQRTNSQGQASQSLEEEKYKLLAEAAVELQEENTRQERILALAKRLAVLKGQ

DPSRV VTLQDYHLPDSDEDEETAIQRVMQQ LTEEAALDEASGFNIPEKPAPGSRAQPCKAEME GPQAEEEELPWCCICNEDATLRCAGCDGDLYCAR

CFR REGHDNFDLKEHQTSPYHPRRPCQEH
Transcript ENSMUST00000102519
Sequence
CGCCGATGGGCGTGTGGGACTGGGCTGCACAACCTGAGGGTCTGAGAGGCCTACCCTGCGCTGGTGAGAGGCTAACCTACCAATTCTGCAGCGCCGAGAA

CTGCTATGGAGAGCAGGTGCTACGGCTGTGCTGTCAAGTTCACCCTCTTCAAGAAGGAG - UNI35963 - TATGGCTGTAAGAATTGTGGCCGAGCC

TTCTGTAACGGCTGTCTTAGCTTCAGCGCTCTGGTACCCCGGGCTGGCAACACACAACAGAAAGTCTGCAAGCAGTGCCACACAATCCTGACCAG AGGG

TCTTCTGACAATGCTTCCAAGTGGTCACCACCTCAGAACTATAAGAA GCGTGTGGCAGCCTTGGAAGCCAAGAAAAAGTCCAGCACTTCCCATAGCCAA

AGCCTGACCCACAAAGACCAAGCCATCGCTGAGCGCCTAGCACGGCTTCGTCAGGAAAACAAGCCTA - UNI5866 - AGTCAGTACCCTCACAAGCC

GAGATAGAGGCACGGCTAGCCGCACTGAAGGATGAAGTCCAGGGCCCCATTCCTTCCACGCAGGAGATGGAGGATCGGCTTGCAGCCTTGCAGGGCAGAG

TCCCACCTTCTCACACCGTGAGACCG GCACACCAGGCACCAGATACCAGGACCCAGGCCCAGCAGACGCAGGATCTGCTAACACAGTTGACAGCTGAGG

TGGCTATTGATGAAAACTGCCAACCAAGAGCCTCAG CCTCTCTCCAGAATGACCTCAACAAGGGAGCTGCGAGAAGCCAGCGCACAAATTCCCAGGGCC

AGGCCAGCCAGTCTCTGGAGGAAGAGAAGTACAAGCTGCTGGCTGAGGCAGCTGTTGAGCTACAGGAGGAGAACACCAGGCAGGAACGGATCCTGGCTCT

TGCCAAAAGATTGGCTGTACTGAAGGGACAGGACCCCAGCAGAG TGACCCTCCAGGACTATCACCTCCCAGACAGTGATGAGGATGAAGAGACAGCCAT

CCAGAGAGTCATGCAGCAG CTCACTGAAGAAGCTGCCCTGGATGAGGCAAGTGGCTTTAACATCCCTGAGAAACCAGCTCCAGGATCCCGGGCCCAACC

CTGCAAGGCAGAGATGGAG GGAGGGCCATGATAACTTTGATCTTAAAGAACATCAGACTTCTCCCTACCACCCCCGACGGCCTTGCCAAGAACACTGAG

GATAACCTAATGATCTCCTGAGGTGGCTGTGCCACAGGCAACCAGCAGGCTGGGAAGACTCCTGGGCCAAGTCTCAGGGCATCCAGGGGGACAGAAGACC

CTGCTCTACTGATGGTAAACACACCCTTTTGTGAGCTTCCCAGTCCCTGGAAGGAAGAAACATAATAAGTCTGAGAGGGGCCAGGTGAGAGGAGGAGTCA

TGGCCCTCCCCTAAGAGGCTGGCCTCAAACAGAGACAGATGGAGAAGACACCATACTGAAGCTAAAAGTGATACCTGAAATCTGCTTCCCAGGCCCAATC

CTGGCTATACTGGGATCTAATAAAATGTGTTGAGCCATTGG
Translation
MESRCYGCAVKFTLFKKE - UNI35963 - YGCKNCGRAFCNGCLSFSALVPRAGNTQQKVCKQCHTILTR RGSSDNASKWSPPQNYKK KRVAALE

AKKKSSTSHSQSLTHKDQAIAERLARLRQENKPK - UNI5866 - KSVPSQAEIEARLAALKDEVQGPIPSTQEMEDRLAALQGRVPPSHTVRP AHQ

APDTRTQAQQTQDLLTQLTAEVAIDENCQPRASA ASLQNDLNKGAARSQRTNSQGQASQSLEEEKYKLLAEAAVELQEENTRQERILALAKRLAVLKGQ

DPSRV VTLQDYHLPDSDEDEETAIQRVMQQ LTEEAALDEASGFNIPEKPAPGSRAQPCKAEME GGP

For any suggestions or comments, please send an email to unitrap@crg.es