Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000068823 (Csde1)
Chromosomal location
Chr 3: 102824530 - 102862108 (+)
Description
cold shock domain containing E1, RNA binding Gene [Source:MGI Symbol;Acc:MGI:92356]
RefSeq_dna
NM_144901 
RefSeq_peptide
NP_659150.1 
UniGene
Mm.373998 Mm.471433 
MGI
MGI:92356 
Uniprot/SWISSPROT
Q91W50 
Uniprot/SPTREMBL
Q05C63 Q3U1S6 Q3U672 Q3UJ74 Q3TXH7 Q3U4S7 Q80TP8 Q8JZN2 Q8R3R1 
Human Ortholog
ENSG00000009307 (CSDE1)
Omim not available
UniTrap UNI7671
Vector Insertion
Chr 3: 102824593 - 102832711
Public Clones (sanger) RRS061 (baygenomics) P132D03 (ggtc) W058F05 (ggtc) H009G02 (ggtc)
D043B12 (ggtc) P111G04 (ggtc) P145C07 (ggtc) E060E02 (ggtc) D009C09 (ggtc)
3SE314A06 (ggtc) P065C06 (ggtc) D145E02 (ggtc) D001B07 (ggtc) H008A12 (ggtc)
P111D01 (ggtc) P141H11 (ggtc) P009H12 (ggtc) D006E09 (ggtc) H002D05 (ggtc)
D038H04 (ggtc) P082F07 (ggtc) E056B05 (ggtc) PST5212-NR (escells) PST21090-NL (escells)
IST14153F3 (tigm) IST14385F11 (tigm) IST12580C11 (tigm) IST14616A5 (tigm)
IST14665G10 (tigm)
Private Clones OST452306 (lexicon) OST314762 (lexicon) OST314075 (lexicon) OST274956 (lexicon)
OST239461 (lexicon) OST215720 (lexicon) OST205750 (lexicon) OST204753 (lexicon)
OST148854 (lexicon) OST80929 (lexicon) OST37052 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI854
Vector Insertion
Chr 3: 102832711 - 102833136
Public Clones CE0406 (sanger) M033E02 (ggtc) P078E06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15239
Vector Insertion
Chr 3: 102833136 - 102842614
Public Clones (sanger) PST10950-NL (escells) PST7140-NR (escells) IST11620A11 (tigm)
IST13055G7 (tigm)
Private Clones OST340721 (lexicon) OST172157 (lexicon) OST56856 (lexicon) OST45417 (lexicon)
OST40916 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17749
Vector Insertion
Chr 3: 102842814 - 102843855
Public Clones IST14198A1 (tigm)
Private Clones OST437059 (lexicon) OST208802 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3969
Vector Insertion
Chr 3: 102843966 - 102844363
Public Clones AS0065 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4198
Vector Insertion
Chr 3: 102848765 - 102850707
Public Clones AM0034 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4799
Vector Insertion
Chr 3: 102859436 - 102860267
Public Clones AS0325 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000029446
Sequence
ATTCCTACGTACCGGGCCGTGCTGCTTATGGCGGCGCTGGAGAGGGGGCGCTGAGCTGTTGGG - UNI854 - - UNI7671 - TATGAAGTGTAAC

AGAACAGACTTTACCACCTGAAACTGCTGCTTCAAGTTCAGATCAGGCAAGGAACAGACCCGCAACAACCAACAACACCAAAGAAGAGTACACAAGTTGA

AGACACAACACTTGATCTGAAACAAGAAGTTTGTGCCTACTCAACAGCTTTGAAAGAGCACTTCCCAACGCTGCTAGTAGTCTTTGTTTTCTTCAGTGCT

GTACTGTGAGATTGCCCGGTGCAGCAGCAGTTGTATTCTTTATTAGCTTGGTAGATCATTTCCTCTCGCTCTCCTTTTTTTTTTCTTTTTTTCTTTTTCT

TTTTTTTTTCTTTTTTTAAATACTAGCAACTTTCATCCTTTGGAACTTGTGCTGAAAAAAGAAGAGTCAGCAAATACTACTGAAAGTGCAATATTTGATT

ATCACTGCGAG - UNI854 - - UNI15239 - ATGAGCTTTGATCCAAACCTTCTCCACAACAATGGACACAATGGGTACCCCAATGGTACTTCAG

CAGCACTTCGTGAAACTGGGGTTATTGAAAAACTCTTGACCTCTTACGGATTCATTCAGTGTTCAGAACGGCAAGCTAGACTTTTCTTCCACTGTTCACA

ATATAATGGCAACCTCCAAGACTTAAAAGTAGGAG - UNI17749 - ATGATGTTGAATTTGAAGTATCATCTGACCGGAGGACTGGGAAACCTATTG

CTATTAAATTGGTGAAGATAAAACCAGAAATACATCCTGAAGAACGAATGAACGGACAA - UNI3969 - GTTGTGTGCGCTGTTCCTCACAACTTAG

AGAGTAAATCTCCAGCTGCCCCGGGTCAGAGTCCAACAGGGAGTGTATGCTACGAACGTAATGGG GAAGTATTTTATCTGACTTACACCTCTGAAGATG

TGGAAGGGAATGTTCAGCTGGAAACTGGAGATAAAATTAACTTTGTAATTGATAACAATAAACA CACTGGTGCTGTAAGTGCTCGTAATATTATGCTGT

TGAAAAAGAAGCAGGCTCGCTGTCAAGGAGTAGTTTGTGCCATGAAG GAGGCGTTTGGCTTTATCGAAAGAGGTGATGTTGTAAAAGAGATATTCTTTC

ACTATAGTGAATTTAAAGGTGACCTAGAAACCCTACAGCCTGGAGATGACGTGGAATTCACAATCAAGGACAGAAAT GGTAAAGAAGTTGCAACAGATG

TCAGACTATTGCCTCAAGGAACAGTCATTTTTGAAGATATCAGCATTGAACATTTTGAAGGAACTGTAACCAAAGTTATCCCAAAAGTACCCAGTAAAAA

CCAG AATGACCCATTGCCAGGACGAATCAAAGTTGACTTTGTGATTCCTAAAGAACTTCCCTTTGGAGACAAAGACACAAAATCCAAAGTGACCCTGCT

GGAAGGTGACCATGTTAGGTTTAATATTTCAACAGACCGACGTGACAAATTGGAACGAGCAACCAACATAGAGGTTCTATCAAATACATTTCAGTTCACT

AATGAAGCCAGAGAGATG - UNI4198 - GGTGTGATTGCTGCCATGAGAGATGGTTTTGGTTTCATCAAGTGTGTGGATCGTGATGCTCGTATGTTC

TTCCACTTCAGTGAGATTCTAGATGGGAACCAGCTCCACATTGCAGATGAAGTAGAGTTTACTGTGGTTCCT GATATGCTCTCTGCCCAAAGAAATCAT

GCTATTAGGATTAAAAAACTTCCCAAGGGCACGGTTTCATTCCATTCCCATTCAGATCATCGTTTTCTGGGCACCGTAGAAAAAGAAGCCACTTTTTCCA

ATCCTAAAACTACAAGCCCAAATAAAGGCAAAGACAAG GAGGCAGAAGATGGCATTATAGCTTATGACGACTGTGGGGTGAAACTGACGATTGCTTTTC

AAGCCAAGGATGTGGAAGGATCTACTTCTCCTCAAATAGGAGATAAG GTTGAATTTAGTATTAGTGACAAACAGAGGCCTGGACAGCAGATTGCAACTT

GCGTGAGACTTTTAGGTCGTAATTCTAACTCCAAACGTCTCTTGGGTTATGTGGCAACTCTGAAAGATAATTTTGGATTTATAGAAACAGCTAATCATGA

TAAGGAAATATTTTTCCACTATAG TGAGTTCTCTGGTGATGTTGATAGCCTGGAACTGGGAGACATGGTTGAATACAGCTTGTCCAAAGGCAAAGGCAA

TAAAGTCAGTGCTGAGAAAGTAAACAAAGCCCACTCAG TGAATGGCATTACTGAGGAAGCTAATCCCACCATCTACTCTGGTAAAGTCATTCGCCCTCT

GAGAGGTGTTGATCCAACACAGATTGAGTACCAAGGAATGATTGAGATTGTGGAGGAGG GGGATATGAAAGGTGAAGTGTATCCTTTTGGCATAGTTGG

GATGGCCAACAAAGGGGATTGCCTACAGAAAGGGGAGAGTGTCAAGTTCCAGTTGTGTGTACTTGGCCAAAATGCACAAACTATGGCCTACAACATCACA

CCCCTTCGTAGGGCTACTGTGGAGTGTGTGAAAGATCAG TTTGGCTTTATTAACTATGAAGTAGGAGATAGCAAGAAGCTCTTTTTCCATGTGAAAGAA

GTTCAGGATGGCGTTGAGCTACAGGCAGGAGATGAGGTGGAATTCTCAGTGATCCTTAATCAGCGCACTGGGAAGTGCAGTGCCTGTAATGTCTGGCGAG

TCTG - UNI4799 - TGAAGGCCCCAAAGCTGTTGCAGCTCCTCGACCTGACCGGTTGGTCAATCGCCTAAAGAACATCACCCTGGATGATGCCAGTG

CTCCACGTCTAATGGTTCTTCGTCAGCCAAGGGGACCAGATAACTCAATG GGATTTGGTGCAGAAAGAAAGATCCGTCAAGCTGGTGTCATTGACTAAC

CACGTCCACAAAGCACATCATTAATTCACTATGGTCGAGTTGGGGGGATTCTGGTGAAGGGTTCTGAATATCTTTCTCTTCATCCCTCCCAAAATCTGGA

ATACTTATTCTATTGAGCTATTACACCAGTTTTAACACCTTCCTCGTGTTATGTTTAAAGAAAAAAATAAATAAATTTAAGAAACCATTTTAAAATTATG

CACAGTTGCAGCCTGGAAAACTTAAAGGTGGCGCCTTATAGTGTCAATTTAGGAGCTTTATTTGGTGCATTTAACGCAACTGGTAATTGCAAATTCCACT

TGGCCTGTGTAAGTGAACAATGCAGACTGTTACTTTGTTGGCCCTATGAAATTCTGCACTCTAGTCAGTATATACTCTACCTTCATGACTTAACACTCAG

CTGCATTCTTTTCCTATTTTTTCCCTGTTCATTATGCTTTAATTCTGAGGACCATATGAAGGTAGAATATATTACCTTTAAAAATTGCAAAAATTTATAT

AGCAAACGATATTCTTAAGTTGATGGCCAAATGTTAAAATGTTATTTTCATATCATTTATAATCTTGTCACAATCCACTTAACGAAGTTTGATTACATTT

CAGTGAAAATTATCTTCCCGAGTAGTTTTTTTTTTTTTTTCTTCCTGGGATGGGGGGGGTAAATAACTTTACTACAATTAGTATGTGTGGTGCAGAATTT

CATGCAAATGAAGTGTGCCAGCAGTGTGATAATTTAAACATATTTAAACAAAAGACGAATGCACAAAATTGCTGCTGCTTAGATCACTGCAGCTTCTAGG

ACCCAGTTTCTTTTACTGATTTAAAAACAAAATGAACAAAAAAATAATAATAATAAAAAAGTTGTGCCTGAAATGAATCCTGTTTTTTTTAATAAATAGC

CCCGTGGTTCCAGTGCCCTGTTCAATACAGGCACTTGATCCTTGGTGTAGCTTCTGTTCAACTTTGTATCACGGGAACGGATTGGCCTGATTTCTCGGCC

TTCATCTTGAATTGGCCCCAAACAGGGTCCCTGGCAAGTGGAGTGAAGGCTTTTTGTCTAACAATGACAAGGGTCAGCTCAGGGGTTGTCGGGGAGGGCG

CTTTCATCTTCCCCGTTGTCATTTGAGGTTTTGAACTCTGGGTAAAGAGGCCGTTTATCTTTGTAAACACAAAACATTTTTGCTTTCTCCGGTTTTATGT

TAATGGCGAAAGAATGGAAGCGAATAAAGTTTTACTGATTTTTGAGACACT
Translation
 - UNI854 - - UNI7671 -  - UNI854 - - UNI15239 - MSFDPNLLHNNGHNGYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFF

HCSQYNGNLQDLKVGD - UNI17749 - DDVEFEVSSDRRTGKPIAIKLVKIKPEIHPEERMNGQ - UNI3969 - VVCAVPHNLESKSPAAPGQS

PTGSVCYERNG EVFYLTYTSEDVEGNVQLETGDKINFVIDNNKH HTGAVSARNIMLLKKKQARCQGVVCAMK EAFGFIERGDVVKEIFFHYSEFKGD

LETLQPGDDVEFTIKDRN GKEVATDVRLLPQGTVIFEDISIEHFEGTVTKVIPKVPSKNQ NDPLPGRIKVDFVIPKELPFGDKDTKSKVTLLEGDHVR

FNISTDRRDKLERATNIEVLSNTFQFTNEAREM - UNI4198 - GVIAAMRDGFGFIKCVDRDARMFFHFSEILDGNQLHIADEVEFTVVP DMLSAQ

RNHAIRIKKLPKGTVSFHSHSDHRFLGTVEKEATFSNPKTTSPNKGKDK EAEDGIIAYDDCGVKLTIAFQAKDVEGSTSPQIGDK VEFSISDKQRPGQ

QIATCVRLLGRNSNSKRLLGYVATLKDNFGFIETANHDKEIFFHYS SEFSGDVDSLELGDMVEYSLSKGKGNKVSAEKVNKAHSV VNGITEEANPTIY

SGKVIRPLRGVDPTQIEYQGMIEIVEEG GDMKGEVYPFGIVGMANKGDCLQKGESVKFQLCVLGQNAQTMAYNITPLRRATVECVKDQ FGFINYEVGD

SKKLFFHVKEVQDGVELQAGDEVEFSVILNQRTGKCSACNVWRVC - UNI4799 - CEGPKAVAAPRPDRLVNRLKNITLDDASAPRLMVLRQPRGPD

NSM GFGAERKIRQAGVID
Transcript ENSMUST00000071942
Sequence
ATTCCTACGTACCGGGCCGTGCTGCTTATGGCGGCGCTGGAGAGGGGGCGCTGAGCTGTTGGG - UNI854 - - UNI7671 - TATGAAGTGTAAC

AGAACAGACTTTACCACCTGAAACTGCTGCTTCAAGTTCAGATCAGGCAAGGAACAGACCCGCAACAACCAACAACACCAAAGAAGAGTACACAAGTTGA

AGACACAACACTTGATCTGAAACAAGAAGTTTGTGCCTACTCAACAGCTTTGAAAGAGCACTTCCCAACGCTGCTAGTAGTCTTTGTTTTCTTCAGTGCT

GTACTGTGAGATTGCCCGGTGCAGCAGCAGTTGTATTCTTTATTAGCTTGGTAGATCATTTCCTCTCGCTCTCCTTTTTTTTTTCTTTTTTTCTTTTTCT

TTTTTTTTTCTTTTTTTAAATACTAGCAACTTTCATCCTTTGGAACTTGTGCTGAAAAAAGAAGAGTCAGCAAATACTACTGAAAGTGCAATATTTGATT

ATCACTGCGAG - UNI854 - - UNI15239 - ATGAGCTTTGATCCAAACCTTCTCCACAACAATGGACACAATGGGTACCCCAATGGTACTTCAG

CAGCACTTCGTGAAACTGGGGTTATTGAAAAACTCTTGACCTCTTACGGATTCATTCAGTGTTCAGAACGGCAAGCTAGACTTTTCTTCCACTGTTCACA

ATATAATGGCAACCTCCAAGACTTAAAAGTAGGAG - UNI17749 - ATGATGTTGAATTTGAAGTATCATCTGACCGGAGGACTGGGAAACCTATTG

CTATTAAATTGGTGAAGATAAAACCAGAAATACATCCTGAAGAACGAATGAACGGACAA - UNI3969 - GAAGTATTTTATCTGACTTACACCTCTG

AAGATGTGGAAGGGAATGTTCAGCTGGAAACTGGAGATAAAATTAACTTTGTAATTGATAACAATAAACA CACTGGTGCTGTAAGTGCTCGTAATATTA

TGCTGTTGAAAAAGAAGCAGGCTCGCTGTCAAGGAGTAGTTTGTGCCATGAAG GAGGCGTTTGGCTTTATCGAAAGAGGTGATGTTGTAAAAGAGATAT

TCTTTCACTATAGTGAATTTAAAGGTGACCTAGAAACCCTACAGCCTGGAGATGACGTGGAATTCACAATCAAGGACAGAAAT GGTAAAGAAGTTGCAA

CAGATGTCAGACTATTGCCTCAAGGAACAGTCATTTTTGAAGATATCAGCATTGAACATTTTGAAGGAACTGTAACCAAAGTTATCCCAAAAGTACCCAG

TAAAAACCAG AATGACCCATTGCCAGGACGAATCAAAGTTGACTTTGTGATTCCTAAAGAACTTCCCTTTGGAGACAAAGACACAAAATCCAAAGTGAC

CCTGCTGGAAGGTGACCATGTTAGGTTTAATATTTCAACAGACCGACGTGACAAATTGGAACGAGCAACCAACATAGAGGTTCTATCAAATACATTTCAG

TTCACTAATGAAGCCAGAGAGATG - UNI4198 - GGTGTGATTGCTGCCATGAGAGATGGTTTTGGTTTCATCAAGTGTGTGGATCGTGATGCTCGT

ATGTTCTTCCACTTCAGTGAGATTCTAGATGGGAACCAGCTCCACATTGCAGATGAAGTAGAGTTTACTGTGGTTCCT GATATGCTCTCTGCCCAAAGA

AATCATGCTATTAGGATTAAAAAACTTCCCAAGGGCACGGTTTCATTCCATTCCCATTCAGATCATCGTTTTCTGGGCACCGTAGAAAAAGAAGCCACTT

TTTCCAATCCTAAAACTACAAGCCCAAATAAAGGCAAAGACAAG GAGGCAGAAGATGGCATTATAGCTTATGACGACTGTGGGGTGAAACTGACGATTG

CTTTTCAAGCCAAGGATGTGGAAGGATCTACTTCTCCTCAAATAGGAGATAAG GTTGAATTTAGTATTAGTGACAAACAGAGGCCTGGACAGCAGATTG

CAACTTGCGTGAGACTTTTAGGTCGTAATTCTAACTCCAAACGTCTCTTGGGTTATGTGGCAACTCTGAAAGATAATTTTGGATTTATAGAAACAGCTAA

TCATGATAAGGAAATATTTTTCCACTATAG TGAGTTCTCTGGTGATGTTGATAGCCTGGAACTGGGAGACATGGTTGAATACAGCTTGTCCAAAGGCAA

AGGCAATAAAGTCAGTGCTGAGAAAGTAAACAAAGCCCACTCAG TGAATGGCATTACTGAGGAAGCTAATCCCACCATCTACTCTGGTAAAGTCATTCG

CCCTCTGAGAGGTGTTGATCCAACACAGATTGAGTACCAAGGAATGATTGAGATTGTGGAGGAGG GGGATATGAAAGGTGAAGTGTATCCTTTTGGCAT

AGTTGGGATGGCCAACAAAGGGGATTGCCTACAGAAAGGGGAGAGTGTCAAGTTCCAGTTGTGTGTACTTGGCCAAAATGCACAAACTATGGCCTACAAC

ATCACACCCCTTCGTAGGGCTACTGTGGAGTGTGTGAAAGATCAG TTTGGCTTTATTAACTATGAAGTAGGAGATAGCAAGAAGCTCTTTTTCCATGTG

AAAGAAGTTCAGGATGGCGTTGAGCTACAGGCAGGAGATGAGGTGGAATTCTCAGTGATCCTTAATCAGCGCACTGGGAAGTGCAGTGCCTGTAATGTCT

GGCGAGTCTG - UNI4799 - TGAAGGCCCCAAAGCTGTTGCAGCTCCTCGACCTGACCGGTTGGTCAATCGCCTAAAGAACATCACCCTGGATGATG

CCAGTGCTCCACGTCTAATGGTTCTTCGTCAGCCAAGGGGACCAGATAACTCAATG GGATTTGGTGCAGAAAGAAAGATCCGTCAAGCTGGTGTCATTG

ACTAACCACGTCCACAAAGCACATCATTAATTCACTATGGTCGAGTTGGGGGGATTCTGGTGAAGGGTTCTGAATATCTTTCTCTTCATCCCTCCCAAAA

TCTGGAATACTTATTCTATTGAGCTATTACACCAGTTTTAACACCTTCCTCGTGTTATGTTTAAAGAAAAAAATAAATAAATTTAAGAAACCATTTTAAA

ATTATGCACAGTTGCAGCCTGGAAAACTTAAAGGTGGCGCCTTATAGTGTCAATTTAGGAGCTTTATTTGGTGCATTTAACGCAACTGGTAATTGCAAAT

TCCACTTGGCCTGTGTAAGTGAACAATGCAGACTGTTACTTTGTTGGCCCTATGAAATTCTGCACTCTAGTCAGTATATACTCTACCTTCATGACTTAAC

ACTCAGCTGCATTCTTTTCCTATTTTTTCCCTGTTCATTATGCTTTAATTCTGAGGACCATATGAAGGTAGAATATATTACCTTTAAAAATTGCAAAAAT

TTATATAGCAAACGATATTCTTAAGTTGATGGCCAAATGTTAAAATGTTATTTTCATATCATTTATAATCTTGTCACAATCCACTTAACGAAGTTTGATT

ACATTTCAGTGAAAATTATCTTCCCGAGTAGTTTTTTTTTTTTTTTCTTCCTGGGATGGGGGGGGTAAATAACTTTACTACAATTAGTATGTGTGGTGCA

GAATTTCATGCAAATGAAGTGTGCCAGCAGTGTGATAATTTAAACATATTTAAACAAAAGACGAATGCACAAAATTGCTGCTGCTTAGATCACTGCAGCT

TCTAGGACCCAGTTTCTTTTACTGATTTAAAAACAAAATGAACAAAAAAATAATAATAATAAAAAAGTTGTGCCTGAAATGAATCCTGTTTTTTTTAATA

AATAGCCCCGTGGTTCCAGTGCCCTGTTCAATACAGGCACTTGATCCTTGGTGTAGCTTCTGTTCAACTTTGTATCACGGGAACGGATTGGCCTGATTTC

TCGGCCTTCATCTTGAATTGGCCCCAAACAGGGTCCCTGGCAAGTGGAGTGAAGGCTTTTTGTCTAACAATGACAAGGGTCAGCTCAGGGGTTGTCGGGG

AGGGCGCTTTCATCTTCCCCGTTGTCATTTGAGGTTTTGAACTCTGGGTAAAGAGGCCGTTTATCTTTGTAAACACAAAACATTTTTGCTTTCTCCGGTT

TTATGTTAATGGCGAAAGAATGGAAGCGAATAAAGTTTTACTGATTTTTGAGACACT
Translation
 - UNI854 - - UNI7671 - LGRSFPLALLFFFFFSFSFFFLFLNTSNFHPLELVLKKEESANTTESAIFDYHCE - UNI854 - - UNI1523

9 - MSFDPNLLHNNGHNGYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFFHCSQYNGNLQDLKVGD - UNI17749 - DDVEFEVSSDRRTGK

PIAIKLVKIKPEIHPEERMNGQ - UNI3969 - EVFYLTYTSEDVEGNVQLETGDKINFVIDNNKH HTGAVSARNIMLLKKKQARCQGVVCAMK EA

FGFIERGDVVKEIFFHYSEFKGDLETLQPGDDVEFTIKDRN GKEVATDVRLLPQGTVIFEDISIEHFEGTVTKVIPKVPSKNQ NDPLPGRIKVDFVIP

KELPFGDKDTKSKVTLLEGDHVRFNISTDRRDKLERATNIEVLSNTFQFTNEAREM - UNI4198 - GVIAAMRDGFGFIKCVDRDARMFFHFSEILD

GNQLHIADEVEFTVVP DMLSAQRNHAIRIKKLPKGTVSFHSHSDHRFLGTVEKEATFSNPKTTSPNKGKDK EAEDGIIAYDDCGVKLTIAFQAKDVEG

STSPQIGDK VEFSISDKQRPGQQIATCVRLLGRNSNSKRLLGYVATLKDNFGFIETANHDKEIFFHYS SEFSGDVDSLELGDMVEYSLSKGKGNKVSA

EKVNKAHSV VNGITEEANPTIYSGKVIRPLRGVDPTQIEYQGMIEIVEEG GDMKGEVYPFGIVGMANKGDCLQKGESVKFQLCVLGQNAQTMAYNITP

LRRATVECVKDQ FGFINYEVGDSKKLFFHVKEVQDGVELQAGDEVEFSVILNQRTGKCSACNVWRVC - UNI4799 - CEGPKAVAAPRPDRLVNRL

KNITLDDASAPRLMVLRQPRGPDNSM GFGAERKIRQAGVID

For any suggestions or comments, please send an email to unitrap@crg.es