Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000068959 (Zfp619)
Chromosomal location
Chr 7: 46773136 - 46795790 (+)
Description
zinc finger protein 619 Gene [Source:MGI (curated);Acc:Zfp619-001]
RefSeq_dna
NM_001004139 
RefSeq_peptide
NP_001004139.2 
UniGene
Mm.333800 Mm.406974 Mm.407925 
MGI
MGI:1917477 
Uniprot/SPTREMBL
Q66JZ1 
Human Ortholog
not available
Omim not available
UniTrap UNI8660
Vector Insertion
Chr 7: 46773235 - 46789162
Public Clones RRK232 (baygenomics)
Private Clones OST434755 (lexicon) OST354432 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1837
Vector Insertion
Chr 7: 46789546 - 46790108
Public Clones BB0350 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000072937
Sequence
GACTTGGTGACCTTTGAGGATGTGGCTGTGAACTTCACCCAGGAAGAGTGGACTTTGCTGGATCCTTCTCAGAAGAACCTATACATTAATGTGATGCTGG

AGACCTGCAGTAACCTTGCTTCTGTGG GAATCAAATCAGAATACCAGACCATTGAAGACCAGTATAAACAGCCTGGGAAAAATATAAG - UNI1837 

- GAACATCATAACCCGCTCCGGATACACTCCATACGCACTTGAGGACTGTGGGGAGAAGCCATATCACTCCAGTTCTCTCACAACAATTCACATATACG

TGGGAATCCACACTGTGAGCGGAGCGTATGGATATGAAGTGTATTCAAAACCTGTGGGTGCTCCAAGTTCATGTGGCACTGGTGAGCAAATTCAGAGTGG

AGAGCAGCCCCATGGATATACTATAAACAAAACAGCCTTTATTTGCCCCAGCTCATTTTGCAGCAGCGAAGTAACTGACACTGAAGAAAACCCTTCTGAA

TGTAAACCAGGTGGTACAACTCTGAGTCCTTTCAATTACCCGCCGTTTTGCAGTGGAACTCATAATGGAGGAAAGCATGTTGACTGTACACAGTGTGTAA

AGGCTTTCAGATGTCACAGTTCCCTTCAGAGACAGGAAAGAATGTGTGCTGAGGAAAAACCCTATGAATGTAAACAGTGTGGTAAGTCATTCGTTTACCC

CTATTTACTTAAAATGCATGAAAGGCATCATACGGGAGAGAAGCCTTATAAGTGTAAGACATGTGGTAAGGCATTTCTTTGTTCCTCTTTCCTGCAAAGA

CATAAAAGAACTCATACAGGAGAAAAACCCTATAAATGTAAGCAGTGTGCTAAGCCCTTTAGACGCCTCAGTAATCTTCAGGTCCACGAGAGAACTCACA

GTGGAGAGAAACCCTATGAGTGTAGAGAATGCGGTAAAGCTCTGAGAAGCCACAGTTCCCTTCAAAGACATAAAATAGTCCACGCTGGGAAGAAACCCTA

CGAATGTAAGCAGTGTGGTAAGTCCTTCATTTATCCCTACTTACTTCAAACCCACGAAAGATCCCATACTGGAGAGAAGCCCTACAAATGTCCCCTGTGC

AGTAAAGCCTTTCGTTGTTCCTCTTTCCTGCAAAGACATGAAAGAACTCACACCGGGGGAAAACCCTACGAGTGTAAGCAGTGTGGTAAGGCTTTCAAAG

GGCACAGCTCCCTTCGCTTGCATGCAAGGTCTCACGGCGGGGAGAAGCCATATAAATGTAATCTATGTAGTAAAGCTTTCCTGTGCCCCTCTTTCCTCCG

AAGACACGAAAGAACTCACACTAGGGAACGGCCCTACGAATGCAGGAAGTGTAACAAAGCCTTCCGAGGTCAGAGTTCTCTTAAGTTACATGAACGATCT

CATACCGGAGAGAAACCCTATAAATGTAAGATCTGTAGTAAAGCCTTTCTATGCTCCTCCTTCCTCCAAAGACATGAAAGGATTCACTGTGAAGAAAAGC

CCTATGTGTGTAAGCAGTCTGGAAAAGACCTTAAAGATAGAAGTTCCTTTCAAAGACAGAAAGTGTCTCATGCTGGCGAAAAGCCTTATGAGTGTAAGCA

GTGTGGTAAGTCCTTCGTTTACCCGTGTTTACTTCAAGTTCACGTCAGAACCCACACTGGTGAGAAACCCTATAGGTGTAAACAGTGTGACAAGGCTTTC

AGAAGTCTCAGTTACCTTCGCATACATGAAGGAAGTCACACCGAGGAAAAGCCCTATGAATGTAAAGAGTGCGGCAAAACCCTCAGCTGCTCCAGCGCCC

TGCAGTTACACACACGGACACACACGGGAGAGAAGCCCTATGTGTGTCAACAGTGTGGGAAAGCCTTCAGGGGATTCAGTTACCTCCGCGTCCACGAAAG

GACCCACACTGAAGCCAAGCCCTACGAGTGCAAGCAGTGTGGGAAAATTCTCAGCTGCTCGAGTTCCCTTCAACTGCACGAAAGAACCCACACTGGGGAG

AAACCTTACTCGTGTAACCAGTGCGGGAAAGCCTTCAGAGGTCTCAGCCGTCTCCGAGTCCACGAGATAATTCATACCGGCGAAAAACCCCACGAATGTA

AACTCTGCGGGAAAGCTTTCCGGTATCGGAGTTTACTTCGCGTCCACGAAAGGACCCACACCGGTGAAAAACCCTATGCTTGTAAACAATGCAGCAAAGC

CTTCAAAAGCCTCAGTAACCTGCGGATACACGAGAAGACTCACAGTGGGTTCTATGAGTGTAAGCAGTGTGGCAAAACCCTCAGTTCTTCCAACTCCCTC

CAAGTACACGAAAGGGTCCACAGTGAAGAAAAATCGCACGCGTGTAAGCAGTGTGGCAAAACCTTCCGCCGGCTCAGTAATCTCCAGGTCCATGAAAAAA

CTCACGCCGAAGGGAAGCCCTACGAGTGCAAGCAATGCGCTAAGTCCTTCCTTTATCAGTATTTACTCGAAAAGCATGAAAAGTCTCACACTGCAGAAAA

GCCCTATAAATGCATGATCTGCAGTAAAGCCTTTATCTGTGCCTCTTTCCTTCAACGGCACGAAAGGATTCATAGCGCAGAAAAACCCTATGAGTGTGTA

CAGTGTGGCAAAGCGTTCAAAGGCCTCAGTTCCCTTCAGCTACACGAAAGAGCCCACGCTAGAGAAAAGCATTATGACTGTACACAGTGTGGTAAAACCT

TCAGATGTCACAGTCTCCTCCAGGCGCATGAAAGAACCCATACCGGTGAAAAACCCTTCGTGTGTGCAGAGTGTGGCAAAACCTTCAAAAGTGCGGGTTA

CCTTCGAATTCATGAAAAAACACACAGTGGTTTCTATGAGTGTAAGCAGTGTGGTAAGATTCTCAGCTGTTCAAGTTCTCTTCAGTTACACGAAAGAACC

CACACCGGCGAAAAACCCTACGAATGTAAGCAATGTGGTAAGGCCTTCAGAAGTCAGAGTTCCCTTAGAAGACACGAAAGGATTCACGCCGGAGAGAAAC

CCTACGAATGCAAGCAGTGTGGGAAGTCCTTCATTTATCCATGCTACCTTCAAATGCACGAGAGATCTCACACCGGAGAGAAGCTCTATAAATGTAAAAT

ATGTAGTAAAGCCTTTCTTTATCCCTGTTTCCTTCAAATGCACGAAAGAACTCACACCGGCGAAAAACCTTATAAATGCAAGCAATGTGCTAAAGCCTTC

CGAAGTCACAGTTCCCTTCAAATGCATGAAAAAACGCATACAGGAGACAGACCCTATGAATGCAAGCAGTGCGGGAAAGTCTTGATAAGTCATAGTTCTC

TTCAGAGGCATAAAATAGCTCATGCCGGGAGGAAACGTTACGAATGTAAACAGTGTGGTAAGTCCTTTGCGTATCCATATTTACTTCAAACTCATGAACG

ATCTCACACTGGAGAGAAGCCCTATGAGTGCAAGGACTGCAGGAAAGCCTTTACTTGTCACCGTTCCCTTCAGAGACACAGAAAAACACACACCTGA
Translation
DLVTFEDVAVNFTQEEWTLLDPSQKNLYINVMLETCSNLASVG GIKSEYQTIEDQYKQPGKNIR - UNI1837 - RNIITRSGYTPYALEDCGEKPY

HSSSLTTIHIYVGIHTVSGAYGYEVYSKPVGAPSSCGTGEQIQSGEQPHGYTINKTAFICPSSFCSSEVTDTEENPSECKPGGTTLSPFNYPPFCSGTHN

GGKHVDCTQCVKAFRCHSSLQRQERMCAEEKPYECKQCGKSFVYPYLLKMHERHHTGEKPYKCKTCGKAFLCSSFLQRHKRTHTGEKPYKCKQCAKPFRR

LSNLQVHERTHSGEKPYECRECGKALRSHSSLQRHKIVHAGKKPYECKQCGKSFIYPYLLQTHERSHTGEKPYKCPLCSKAFRCSSFLQRHERTHTGGKP

YECKQCGKAFKGHSSLRLHARSHGGEKPYKCNLCSKAFLCPSFLRRHERTHTRERPYECRKCNKAFRGQSSLKLHERSHTGEKPYKCKICSKAFLCSSFL

QRHERIHCEEKPYVCKQSGKDLKDRSSFQRQKVSHAGEKPYECKQCGKSFVYPCLLQVHVRTHTGEKPYRCKQCDKAFRSLSYLRIHEGSHTEEKPYECK

ECGKTLSCSSALQLHTRTHTGEKPYVCQQCGKAFRGFSYLRVHERTHTEAKPYECKQCGKILSCSSSLQLHERTHTGEKPYSCNQCGKAFRGLSRLRVHE

IIHTGEKPHECKLCGKAFRYRSLLRVHERTHTGEKPYACKQCSKAFKSLSNLRIHEKTHSGFYECKQCGKTLSSSNSLQVHERVHSEEKSHACKQCGKTF

RRLSNLQVHEKTHAEGKPYECKQCAKSFLYQYLLEKHEKSHTAEKPYKCMICSKAFICASFLQRHERIHSAEKPYECVQCGKAFKGLSSLQLHERAHARE

KHYDCTQCGKTFRCHSLLQAHERTHTGEKPFVCAECGKTFKSAGYLRIHEKTHSGFYECKQCGKILSCSSSLQLHERTHTGEKPYECKQCGKAFRSQSSL

RRHERIHAGEKPYECKQCGKSFIYPCYLQMHERSHTGEKLYKCKICSKAFLYPCFLQMHERTHTGEKPYKCKQCAKAFRSHSSLQMHEKTHTGDRPYECK

QCGKVLISHSSLQRHKIAHAGRKRYECKQCGKSFAYPYLLQTHERSHTGEKPYECKDCRKAFTCHRSLQRHRKTHT
Transcript ENSMUST00000108015
Sequence
CCCTTTAAGGCTGAGCGAGGTGCCACTTGAGCCGCGCTTGCGAGCTCCGCTGCCAGGACCTGTGGGGAGAGTGCAGTCGAGATCGGAAGCCGCGCCATG 

- UNI8660 - GACTTGGTGACCTTTGAGGATGTGGCTGTGAACTTCACCCAGGAAGAGTGGACTTTGCTGGATCCTTCTCAGAAGAACCTATACATTA

ATGTGATGCTGGAGACCTGCAGTAACCTTGCTTCTGTGG GAATCAAATCAGAATACCAGACCATTGAAGACCAGTATAAACAGCCTGGGAAAAATATAA

G - UNI1837 - GAACATCATAACCCGCTCCGGATACACTCCATACGCACTTGAGGACTGTGGGGAGAAGCCATATCACTCCAGTTCTCTCACAACAA

TTCACATATACGTGGGAATCCACACTGTGAGCGGAGCGTATGGATATGAAGTGTATTCAAAACCTGTGGGTGCTCCAAGTTCATGTGGCACTGGTGAGCA

AATTCAGAGTGGAGAGCAGCCCCATGGATATACTATAAACAAAACAGCCTTTATTTGCCCCAGCTCATTTTGCAGCAGCGAAGTAACTGACACTGAAGAA

AACCCTTCTGAATGTAAACCAGGTGGTACAACTCTGAGTCCTTTCAATTACCCGCCGTTTTGCAGTGGAACTCATAATGGAGGAAAGCATGTTGACTGTA

CACAGTGTGTAAAGGCTTTCAGATGTCACAGTTCCCTTCAGAGACAGGAAAGAATGTGTGCTGAGGAAAAACCCTATGAATGTAAACAGTGTGGTAAGTC

ATTCGTTTACCCCTATTTACTTAAAATGCATGAAAGGCATCATACGGGAGAGAAGCCTTATAAGTGTAAGACATGTGGTAAGGCATTTCTTTGTTCCTCT

TTCCTGCAAAGACATAAAAGAACTCATACAGGAGAAAAACCCTATAAATGTAAGCAGTGTGCTAAGCCCTTTAGACGCCTCAGTAATCTTCAGGTCCACG

AGAGAACTCACAGTGGAGAGAAACCCTATGAGTGTAGAGAATGCGGTAAAGCTCTGAGAAGCCACAGTTCCCTTCAAAGACATAAAATAGTCCACGCTGG

GAAGAAACCCTACGAATGTAAGCAGTGTGGTAAGTCCTTCATTTATCCCTACTTACTTCAAACCCACGAAAGATCCCATACTGGAGAGAAGCCCTACAAA

TGTCCCCTGTGCAGTAAAGCCTTTCGTTGTTCCTCTTTCCTGCAAAGACATGAAAGAACTCACACCGGGGGAAAACCCTACGAGTGTAAGCAGTGTGGTA

AGGCTTTCAAAGGGCACAGCTCCCTTCGCTTGCATGCAAGGTCTCACGGCGGGGAGAAGCCATATAAATGTAATCTATGTAGTAAAGCTTTCCTGTGCCC

CTCTTTCCTCCGAAGACACGAAAGAACTCACACTAGGGAACGGCCCTACGAATGCAGGAAGTGTAACAAAGCCTTCCGAGGTCAGAGTTCTCTTAAGTTA

CATGAACGATCTCATACCGGAGAGAAACCCTATAAATGTAAGATCTGTAGTAAAGCCTTTCTATGCTCCTCCTTCCTCCAAAGACATGAAAGGATTCACT

GTGAAGAAAAGCCCTATGTGTGTAAGCAGTCTGGAAAAGACCTTAAAGATAGAAGTTCCTTTCAAAGACAGAAAGTGTCTCATGCTGGCGAAAAGCCTTA

TGAGTGTAAGCAGTGTGGTAAGTCCTTCGTTTACCCGTGTTTACTTCAAGTTCACGTCAGAACCCACACTGGTGAGAAACCCTATAGGTGTAAACAGTGT

GACAAGGCTTTCAGAAGTCTCAGTTACCTTCGCATACATGAAGGAAGTCACACCGAGGAAAAGCCCTATGAATGTAAAGAGTGCGGCAAAACCCTCAGCT

GCTCCAGCGCCCTGCAGTTACACACACGGACACACACGGGAGAGAAGCCCTATGTGTGTCAACAGTGTGGGAAAGCCTTCAGGGGATTCAGTTACCTCCG

CGTCCACGAAAGGACCCACACTGAAGCCAAGCCCTACGAGTGCAAGCAGTGTGGGAAAATTCTCAGCTGCTCGAGTTCCCTTCAACTGCACGAAAGAACC

CACACTGGGGAGAAACCTTACTCGTGTAACCAGTGCGGGAAAGCCTTCAGAGGTCTCAGCCGTCTCCGAGTCCACGAGATAATTCATACCGGCGAAAAAC

CCCACGAATGTAAACTCTGCGGGAAAGCTTTCCGGTATCGGAGTTTACTTCGCGTCCACGAAAGGACCCACACCGGTGAAAAACCCTATGCTTGTAAACA

ATGCAGCAAAGCCTTCAAAAGCCTCAGTAACCTGCGGATACACGAGAAGACTCACAGTGGGTTCTATGAGTGTAAGCAGTGTGGCAAAACCCTCAGTTCT

TCCAACTCCCTCCAAGTACACGAAAGGGTCCACAGTGAAGAAAAATCGCACGCGTGTAAGCAGTGTGGCAAAACCTTCCGCCGGCTCAGTAATCTCCAGG

TCCATGAAAAAACTCACGCCGAAGGGAAGCCCTACGAGTGCAAGCAATGCGCTAAGTCCTTCCTTTATCAGTATTTACTCGAAAAGCATGAAAAGTCTCA

CACTGCAGAAAAGCCCTATAAATGCATGATCTGCAGTAAAGCCTTTATCTGTGCCTCTTTCCTTCAACGGCACGAAAGGATTCATAGCGCAGAAAAACCC

TATGAGTGTGTACAGTGTGGCAAAGCGTTCAAAGGCCTCAGTTCCCTTCAGCTACACGAAAGAGCCCACGCTAGAGAAAAGCATTATGACTGTACACAGT

GTGGTAAAACCTTCAGATGTCACAGTCTCCTCCAGGCGCATGAAAGAACCCATACCGGTGAAAAACCCTTCGTGTGTGCAGAGTGTGGCAAAACCTTCAA

AAGTGCGGGTTACCTTCGAATTCATGAAAAAACACACAGTGGTTTCTATGAGTGTAAGCAGTGTGGTAAGATTCTCAGCTGTTCAAGTTCTCTTCAGTTA

CACGAAAGAACCCACACCGGCGAAAAACCCTACGAATGTAAGCAATGTGGTAAGGCCTTCAGAAGTCAGAGTTCCCTTAGAAGACACGAAAGGATTCACG

CCGGAGAGAAACCCTACGAATGCAAGCAGTGTGGGAAGTCCTTCATTTATCCATGCTACCTTCAAATGCACGAGAGATCTCACACCGGAGAGAAGCTCTA

TAAATGTAAAATATGTAGTAAAGCCTTTCTTTATCCCTGTTTCCTTCAAATGCACGAAAGAACTCACACCGGCGAAAAACCTTATAAATGCAAGCAATGT

GCTAAAGCCTTCCGAAGTCACAGTTCCCTTCAAATGCATGAAAAAACGCATACAGGAGACAGACCCTATGAATGCAAGCAGTGCGGGAAAGTCTTGATAA

GTCATAGTTCTCTTCAGAGGCATAAAATAGCTCATGCCGGGAGGAAACGTTACGAATGTAAACAGTGTGGTAAGTCCTTTGCGTATCCATATTTACTTCA

AACTCATGAACGATCTCACACTGGAGAGAAGCCCTATGAGTGCAAGGACTGCAGGAAAGCCTTTACTTGTCACCGTTCCCTTCAGAGACACAGAAAAACA

CACACCTGAGGGGAAGGCTCTGTAAATGCAAACTAGATTAGACTACCTAGTTCTCTTCAAATGTGTGAAAGTACTGGGAAAAAGAGCTAATGAATGTAAA

ACAAATGCTGAAGTTTGTTGTTGTTGTTATTGCTGTAGTTTGCTATGGAAAGTTTAGAAGGATTCATTTGGGGGAGGGGAACCCTTGAATTGTGCTAAGA

CCCTCAGTTCCATTTGAAGACATGAAACTACCTGGTGTTAAAACTCAGAATGTAATATGGTATTTCATTTCTTAGATCTACTAAAAAATACATAAGCTAA

TGAAGGTAGTCACTTGGGAAGTAAAGCTTGTATTTTAACAATACTAAAAATCATGTGATAACTCTGATTAGGGGATCTTACAAATCTATGTGTATCCTGA

GCTTGTTCCCGCCCGCAGAAACACACACAGGACACGCCAGATTCTTCCGTGGTTAACTTTACTTCATAACATATTGTGGTAGACAAAGAAGGCTCAGAAA

GTATGTGGCTTAAATACCCTTAAGGCGTGACGTGTCTAAACTAGGACTGGTAGCTACACCCACGAACCTCATGCACCCTAGGGATAGGCTAAACGCCCCA

GGGGTTGGGCTAGTGCCCTGGGGGATGGACCGTGCCCGGAAATGGGCTGGTGACTTTTGGCGGGTTTTTGCTTTTAGCACATGCGCATATAGCTTGTTCT

TTGTTTAGGTGGTATAAGGCACTGCGGAGCCAGCACCATCTTAAGATGGTAAATGTTATTGCGGCTCTCTACACTATGTGTGTTGAAATGTTGAAGCAAA

TCATGCTAAAAGCTTTATAACATGAATAAAAAGCTATGCATTTTATGAATGTATGGTGGTTTCCAGTGATTTGCATTTGAAGATATTCCCAGCTGCCCCT

GATAGATCAGGCCGGTACTCTTGGGTACTCTGGTTTGCTGCAGCTGATAGCAAGTTCAGGGCCAGCCCAGACAACTTAGTGAGACCAGTCTCAATAAAAA

ATTGGAAAGAAAACCAAAGCCACTCATTAATTGAGCTCTGGTCTCCCAGTGTAATTTCTAGTCCTAGCATAAGAGAAATGAGAAGGCGCCTAGGTGATGA

ATTTCCATTTCTTTTACAGGAAAACACTGAAGTGAAAGTTTCCTAAGTGTAGACATGAACTTTAACTGCAGAAATAGCTGATGCAGATTGCTAGACAATC

TCTTAATTACCATAGATGTACCTGATAGTGTAGCCCACCATACACTTATGCTACATGGTATCAGTACTCCACTAGTCTGTGGAATGTCGCTTCATTGTAT

ATTTTAGGCATGGTACCAACAAATATGTATCAAAAAAACATTTGGCATGAAAGTAAATGCTGTATCTATGAAGAGTACTTATTGTGAGTGGAGTTTTGAG

GACTGGATTTTATTCAATCAGAGACTTAGGTGAATATAAACTCCTAGGACACATTAATCTACTGTAAAGTTTCAATACTATAGACTTAGTTTATTGTATA

TTGATGTTTTCCTAAATATTAAACTAACTTAAAGCTTTATACAGTGTGTATAATTTTAATACTTTTGATTTTTGTGAGAACAGTGCTTAAAATGTAGCCA

TTTTATGATTGTTTAAAACTATTTCTTTGTATGCATATTCTATATATATTTTTGCATTATAAATACGTTTTTAAAAACATTGTGAAAACCAGCTGTCACT

TAGAACAGAGGCAGGAGGGTTGGTATAGCTTTCAGATCTATATGCACTGATTCTCATGTGCTCCCACATCACTCCCCTACGTTGTATCGTATGATTAACT

GCACCTTCCTTTGTTCTGATCATATGACATTGGCATTGCATGTGATGTCATCCCATGCAATGCCTACTAACAGCTCCTTGAAGCACCTCAGCTCACACAC

AAGACTTGCTGAATGTTGCAAACGGAAGTACTTTTACTAAATAACCAGACTTTTCGGCTCTTATGGAAATAATGATTTCGTTGTGGGAAACAGACCGTCC

TGTTTTTCCAGTGTCATTCATCAGCATGTAAGTACTAGATTAACTTATCTTTCCATTATACTGTAGAGTTTACCTTTAAAAGTTGCCTGAGTTACTGACT

TGTATTTTATTGAAAAAGAATCATTCAATAATTATTGGGTTTCAATAATGAAAAATATTTTTAACAACTTATGAAATGGTCCTATCTGTATTTCTGCCTA

GTATTTTATGTGATGTTCTTTATATTTTCCAAGTATAAAGCCAAAGTATCAACTCTGAAAAACATTGATTCCCTGTTCACTGCATTATCAAATACTCAGC

CAAGATTTACTCTTTTATGTAAAAATAAGTATGCCTATTTTATTAATGTACAAGCTTAACTTTCATAATAAATGATAAAATTATCTAGTTACCAAA
Translation
M - UNI8660 - DLVTFEDVAVNFTQEEWTLLDPSQKNLYINVMLETCSNLASVG GIKSEYQTIEDQYKQPGKNIR - UNI1837 - RNIITRSG

YTPYALEDCGEKPYHSSSLTTIHIYVGIHTVSGAYGYEVYSKPVGAPSSCGTGEQIQSGEQPHGYTINKTAFICPSSFCSSEVTDTEENPSECKPGGTTL

SPFNYPPFCSGTHNGGKHVDCTQCVKAFRCHSSLQRQERMCAEEKPYECKQCGKSFVYPYLLKMHERHHTGEKPYKCKTCGKAFLCSSFLQRHKRTHTGE

KPYKCKQCAKPFRRLSNLQVHERTHSGEKPYECRECGKALRSHSSLQRHKIVHAGKKPYECKQCGKSFIYPYLLQTHERSHTGEKPYKCPLCSKAFRCSS

FLQRHERTHTGGKPYECKQCGKAFKGHSSLRLHARSHGGEKPYKCNLCSKAFLCPSFLRRHERTHTRERPYECRKCNKAFRGQSSLKLHERSHTGEKPYK

CKICSKAFLCSSFLQRHERIHCEEKPYVCKQSGKDLKDRSSFQRQKVSHAGEKPYECKQCGKSFVYPCLLQVHVRTHTGEKPYRCKQCDKAFRSLSYLRI

HEGSHTEEKPYECKECGKTLSCSSALQLHTRTHTGEKPYVCQQCGKAFRGFSYLRVHERTHTEAKPYECKQCGKILSCSSSLQLHERTHTGEKPYSCNQC

GKAFRGLSRLRVHEIIHTGEKPHECKLCGKAFRYRSLLRVHERTHTGEKPYACKQCSKAFKSLSNLRIHEKTHSGFYECKQCGKTLSSSNSLQVHERVHS

EEKSHACKQCGKTFRRLSNLQVHEKTHAEGKPYECKQCAKSFLYQYLLEKHEKSHTAEKPYKCMICSKAFICASFLQRHERIHSAEKPYECVQCGKAFKG

LSSLQLHERAHAREKHYDCTQCGKTFRCHSLLQAHERTHTGEKPFVCAECGKTFKSAGYLRIHEKTHSGFYECKQCGKILSCSSSLQLHERTHTGEKPYE

CKQCGKAFRSQSSLRRHERIHAGEKPYECKQCGKSFIYPCYLQMHERSHTGEKLYKCKICSKAFLYPCFLQMHERTHTGEKPYKCKQCAKAFRSHSSLQM

HEKTHTGDRPYECKQCGKVLISHSSLQRHKIAHAGRKRYECKQCGKSFAYPYLLQTHERSHTGEKPYECKDCRKAFTCHRSLQRHRKTHT

For any suggestions or comments, please send an email to unitrap@crg.es