Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000069044 (Usp9y)
Chromosomal location
Chr Y: 635404 - 796225 (-)
Description
ubiquitin specific peptidase 9, Y chromosome Gene [Source:MGI (curated);Acc:Usp9y-001]
RefSeq_dna
NM_148943 
RefSeq_peptide
NP_683745.2 
UniGene
Mm.347376 
MGI
MGI:1313274 
Uniprot/SPTREMBL
Q91XW2 
Human Ortholog
ENSG00000114374 (USP9Y)
Omim 400042 - SERTOLI CELL-ONLY SYNDROME, Y-LINKED  415000 - SPERMATOGENIC FAILURE, NONOBSTRUCTIVE, Y-LINKED  
UniTrap UNI34600
Vector Insertion
Chr Y: 780945 - 783353
Public Clones IST13826A7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34115
Vector Insertion
Chr Y: 732052 - 748966
Public Clones IST14885E7 (tigm) IST14277A6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35250
Vector Insertion
Chr Y: 693176 - 701225
Public Clones IST12073G8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35611
Vector Insertion
Chr Y: 646952 - 650301
Public Clones IST14870D3 (tigm) IST14488E2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000091188
Sequence
TTTTCACTTCTTAGCGTCGTCGTTGGGGCCGCCATCTTATTTTTAAGTGAACAAACTTTAAATTTCTTTTCTCCCTGATTGCTGTTGCTGGGTGCCACTT

TCCTTCACGTTGGTGGTCACTTTGTGGTGTCATAAGGATCAGAACAGGGATCAAAGAAAAGTGAAGCTGTAACTGCCGGAGAAATCAGAGGTGACTCCGG

AAAAACGGCTCTTAGACTGAACTCTACGATTAGAGCTCCGTCTCCCAAGACAGAAAAAAG GTTTTCAATATTCCTACAAAAACATGTCTGAGTTG AGA

ACTCTGAAAATAAATGATCTATAGTCCTGTGAGGAATCCAGAGTTGACATACATTGCCTTCCACTTAAGAACTG GACAAATGCATAAACAGACAAACTA

GAAAAGGTCTGCTCTTTGATCATGACAATCACAACTCGTGGCTCTCCAGTAGGAGAGAATGAGAGCCAGGGTCAGACTTCTGATGGACAACCTCAGCCTT

CTTTCCAACAGAACCAG ATCTCATCATCTGATTCTTCCAATGAGACTTCTCCAACAACTCCTCCATATGAACAAGGCCAAGGTGATGCTCCACCACAGC

ATGAAGAAGAGGATCCTTCATTTCCTCATACTGACCTGGCAAAGTTAGAAGACATGATCAACAG - UNI34600 - GTCCCGATGGGTGGTTCCTGTT

TTGCCAAAGGGAGAATTAGAAGTACTTTTAGAAGCTTCTATTGATCTTACTAAAAAAG - UNI34600 - GTCTGGATGTTAAAAGTGAAGCATGCCA

GCGTTTTTTTCGCGATGTTTTAACTGTGTCTTTTTCCAAAATCCTTATGGATGAGGCTGTGAGTGGATGGAAGTTTGAAATTCAT - UNI34600 - A

GGTGTATTATTAACAATACCCATCGCCTGGTGGAGCTTTGTGTGGCCAAATTGTCTCAGGACTGGTTTCCATTTCTAGAACTTCTAGCAATTGCATTAAA

TCCTCATTGCAAATTTCATGTCTATAATGGTGCACGTCCATGTGAATCAGTGTCCTCAAGTGTTCAGTTTCCTGAAGATGAACTCTTTGCCTGTTCTCCA

GACCTACATTCACCAAAA GGTTGGTTAGTGGACCTCATTAACACATTTGGCACACTAAATGGTTTCCAGATTTTGCATGATCGTTTCACTAGTGGATCA

GCATTAAATGTTCAAACAATTGCAGCTCTTATTAA GCCGTTTGGACAGTGCTATGAGTTTCTCACTCAACATACATTAAGAAAGTACTTCATTCCAGTT

ATAGAAGTAGTTCCACAAATATTACAAAAATTAACTAATGAAGAACTGAAAAAAGAAACAAAGACTGAAGTGAAAAATGATACCATTTCAATGATTATTA

AATTTCTAAAAAATTTAGCTTCAAGAATTCCAGGACAAGAGGAAACTGTTAAAAATTTAGAAACTTTTAGGTTAAAAATGATACTCAG ATTGCTACAGA

TTTCTTCTTTTAATGGAAAGATGAATGCACTGAATGAAATTAACAAAGTGCTTTCAAGTGTGTCATATTATACGCATGGACATGGTAATTCTGAAGAAGA

GTGGCTAACCGTTGAGCGAATGACA GAGTGGATACAGCAGAACAATATCTTATCCATTGTCTTGCAAGATAGCCTACATCAACCACAGTATGTGGAAAA

AATAGAGAAGATTCTTCGTTTTGTAATTAAAGAAAAGGCTCTTACTTTACAGGATCTTAATAATATCTGGGCAGCACAG - UNI34112 - GCTGGAA

AACATGAAGCTATTGTGAAGAATGTTCATGATTTACTAGCAAAATTGGCTTGGAATTTTTCTCCTGAACAACTTGATCATCTCTTTGATTGCTTTAAG -

 UNI34112 - GCAAGCTGGACAAATGCAAGTAAAAAACAACGTGAAAAACTACTTGAATTGATACGTCGTCTTGCAGAAGATGATAAAGATGGTGTAA

TGGCACACAAAGTGTTGAATCTTCTTTGGAATCTAGCTCACAGTGATGACGTGCCTGTAGATATCATGGATCTGGCTCTCAGTGCCCACATAAAAATACT

GGATTATAGTTGTTCCCAG - UNI34112 - GATCGAGATACACAAAAAATCCAGTGGATAGACTGCTTTATAGAAGAATTTCGAACAAATAATAAAT

GGGTCATCCCTGCATTAAAACAAATTAAAGAAATTTGTAGTTTGTTTGGTGAAGCACCTCAAAATTTAAG TCAAACTCATCAAAGTCCCCGTGTATTTT

ATCGTCATGACTTAATCAGCCAACTTCAGCATAATCATGCTTTAGTTACTTTGGTAGCAGAAAACCTTGCAGCTTACATGAACAGCATAAGATTGTATGC

TAGAG ATCATGAAGATTATGACCCACAAACTGTAAGACTAGGAAGTAGATACAGTCATGTTCAAGAAGTCCAAGAACGGCTTAATTTCCTCAG ATTCT

TACTGAAGGATGGTCAACTCTGGCTCTGTGTTTCCCAGGCAAAACAAATATGGAACTGTTTAGCAGAGAATGCCGTTTACTTTAGTGATCGAGAAGCCTG

TTTTATGTGGTATTCCAAATTAATGGGAGATGAACCTGACTTACATCCTGATATTAATAAGGAGTTTTTCGAAAGTAATGTGCTTCAGCTTGATCCTTCT

CTATTAACTGAAAATGGGATGAAATGTTTTGAAAGATTTTTCAAAACTGTTAATTGTCGAGAAGGGAAACTAATGATAAAAAGAAAAATCTATATGATGG

ATGATTTGGACTTAATAGGATTAGACTACCTTTGGAAG GTTGTGATTCAGAGTAATGATGATATTTCAAGCAGAGCAATAGATCTTCTTAAAGAGATAT

ACACAAGCCTTGGTCCCAAATTGCAAGCTAATCAG GTAGTAATTCATGAAGACTTTATTCAATCTTGCTTTGATCGCTTGAAAGCCTCATATGATACAT

TGTGTGTTTTGGATAGTGAAAAAGACAATATTTTTAGCTGTGCAAGACAAGAAGCCATCCGAATGGTTCGCATATTAACGGTCTTAAGGGAATACATAAG

TGAATATGACAGTGATTATCATGAGGAAAGGATGATTCTACCTATGTCAAG AGCATTTCGTGGAAAACACTTGTCTTTTACAGTACGATTTCCAAACCA

GGGCAAAGAGGTTGAGGATTTGGACATATTGTCTCATACAAACGCTACCATTGGTTCTGTGCGACGCTGCATTCTCAATCGTATGAATGTCAATGTAGCC

CATACAAAAATTGAACTGTTTATAGGTGGAGAGTTAGTAGCGTCTGAAGATGACAGAAAGCTAGTTGAACAGTTAAATTTGAAAGATAAATCA CTAATT

ACTGCTAAATTTATACAAATAAATTCCAACATGCCTTCAAGTCCTGATAGCTCATCTGATTCGTCAGCTGGACCTCCTGGAAACCATAGTCATAATAACT

ACAGAGATGTTTCCAATCCAGAAATGGAAAAGTGTTTACCTGGGGTG - UNI35250 - ATAATGTCACTGCAGCCCAGATACATATCTTTCCTTTGG

CAAGTTGCAGACTTAGGTAGCATGTTGACTGTGCCAACTCTTAGAGATGGAGCAAGAATACTTATGAAACTTATGCCACCAG - UNI35250 - ATAG

CACAACTCTAGAACAATTAAGAGCTCTATGTTCAGACCATGTAAATCTTGGAGAAAGACGACTTGGTCAATCTCTTCACTCACTTTTCTTTGGTTCTTCT

GCCTCCCAAGTGCTATATTTAACAGAG - UNI35250 - GTAGTTTACACCTTGTTAATGCCTGCTGGTGCACCTCTGGCTGATATTTCCTCTGACTT

TCAGTATCACTTCTTGAAAAGTGGTGGCTTACCTCTTGTACTAAGTATGCTGATACAAAATAACTTCTTACCAAATACAGATGTTGAAACTCGTAGAGAT

GCTTACTTCAGTGCCCTTAAAATAGCCAAACTGTTGTTAACTATCGTTGGCTATGGCCATGTTCAGGCCATAGCAGAAGCTTGTCAGCCTGTTGCAGATG

GCACAGATCCTAAAACACCG ATTAACCAGGTTACTCATGATCAAGCTGTGGTGCTACAAAATGCCCTTCAAAGCATTCCTAATCCTTCTTCTGAGTGCA

TGCTTAGAAATGTATCAGTTCATCTTGCTCAACAAATATCAGGGTTG GCCTCAAGATATATACCTGATATTTGTGTTATTAGAGCTATACAAAAAATCA

TCTGGGCAGCAGGATGTGGATCATTAGAGCTAGTTTTTAGTCCAAATGAAGATATCACAGAAACTTACAAGATG ACCACCAGTACAAGGAGTAATCTAG

AAGTGAAAGATGAACAAGTTTGCTGTGAAGCCCTGGAAGTGATGACATTATGTTTTGCTTTAATTCCAACTGCTATGGATTCACTCAATAAAGAAAAGGC

CTGGCAGTCATTTGTCATTGACTTACTATTGTACTGTCCTAGCAA AACTGTACGGCAGTTGGCACAGGAGCAGTTCTTTTTAATATGTACCAGATGTTG

CATGGGACATAGACCTTTGCTGTTCTTCATTACTCTACTCTTTACCATTTTGGGG GGTGCAGCTAACGAGAAGGGTAAACATTCAGATGTCTACTTCAC

ACTTTTAAGGCGTCTTCTCACTTATGCTTACAACAGCAACATTCAAGTTCCCAATGTTGATGTTCTTCTCAATGACGAAATTGATTGGCTTAAAAGGGTT

AGG GATTACATTAAAAATACAGGAGAAACAAATGTAGAAGACCCAATCTTAGAAGGCCATCTGGGAGTAACAAAAGAGTTACTGTCTTTTCAGTCTCCT

GAAAAAAAGTATCATATTGGTTGTAAAACAGGAGGTGCTAATCTTGTTAAA GAATTAATTGATTATTTCATCTTTCCTGCATCCAAAGCTTACCTGCAA

TATATGAGAAGTGGGGAATTGCCAATCAAGCAAGCTATTCCAGTCTGTGGTTCACCAGCTACAATTAATGCTGGTTTTGAACTACTTGTAGCTTTGGCTT

TTGGTTGTGTAAGGAATCTTAAACAGATAGTAAACTGTTTGACTGAACTGTTTTACATAGGCACACCAGTAACTA CTTGTGAAGCCGTTGGTGAATGGG

AATATTTACCCCCTGTTGGGCCCCGCCCACCAAAAGGATTTGTGGGACTGAAAAATGCTGGTGCTACTTGTTATATGAACTCTGTGATCCAACAGCTATA

CATGATTCCTTCAATCAGGAACAGTATTCTTGCAATTGATAGCATATGGAGTGATACAGATGATGATATATTCAAAGGTGAAAAGCAGGACAGTGAG AA

TAATGTTGATCCCAGAGATGATGTATTCAGATATCCTCATCAATTTGAAGATAAACCAACATTAAGTAAAGTAGAAGATCGGAAAGAGTACAACATTGCT

GTTTTAAAACACCTTCAGATAACCTTTGGACATTTAGCTGCTTCTCAACTACAATACTATGTGCCAAAAGGATTTTGGCAACAATTCAG GCTTTGGGGT

GAACCTGTTAATCTCCGTGAGCAACATGATGCATTAGAGTTTTTTAATTCTTTGGTGGATAGTTTAGATGAAGCTTTTAAAGCTTTAGGATATCCAACTG

TGCTTAGTAAAGTCCTTGGAGGATCCTTTGCTGATCAGAAGATTTGCCAAGGCTGCCCACATAG GTATGAATGTGAAGAATCTTTTACAACATTAAATG

TAGACATTAGAAATCACCAAAATCTTCTTGATTCTTTGGAGCAGTATGTTAAAGGAGATTTATTAGAGGGTGCAAATGCATATCACTGTGAAAAATGTGA

TAAAAAG GTTGATACAGTAAAACGCTTATTGATTAAAAAACTACCTTCTGTTCTTACTATCCAACTGAAACGATTTGACTATGATTGGGAAAGAGAATG

TGCAATCAAATTCAATGATTACTTTGAATTTCCAAGAGAATTGGATATGGAACCTTACACAGTAGCAGGTGCCACAAAGCTGGAAGGTGACAGTGTAAAT

CCACAGACTCAATTGATTAAACAGAATGAGCAGTCTGAAAGTGTCATACCAGGAAGCACAAAATATCGACTTGTTGGTGTGCTTGTACACAGTGGTCAAG

CAAATGGTGGACATTATTATTCTTACATCATTCAAAGAAATGGTAAAGACAGTAAGAGAAGTCACTGGTTCAAATTTGATGATGGAGATGTAACAGAATG

TAAAATGGATGATGATGAAGAAATGAAAAATCAGTGCTTTGGTGGAGAGTATATGGGAGAAGTTTTTGATCATATGATGAAGCGTATGTCATACAGGCGT

CAGAAAAGATGGTGGAATGCTTACATTCTTTTTTATGAACGGATGGATATAACTGATGAAGATGATGAGATAATAACATATATATCAGAGCTAACATTTA

CCAGACCTCATCAGATTATGTCACCAGCCATTGAGAGAAGTGTATGGAAACAGAATGTGCAATTCCTGCATAACCAAATGCAGTTTAGCTTAGAATATTT

TCAGTTTATTAAAAAACTGCTTACATGTAATGCTGTGTACTTAAGCCCTGCTCCAG GACAAGATCACTTGCTACCAGAAGCAGAAGATATCACAATGAT

CAGCATTCAGCTTGCTTCTAGATTCCTCTTTACTACTGGATTTCATACTAAGAAAATAATCCGTGGACCTGCCAATGACTG GTATGACGCACTTTGTAT

TCTCCTCCGTCACAGCAAGAATGTACGTTTTTGGTTTGTTCATAATGTCCTCTTTAATGTATCAAATCGTTTCTCTGAGTACCTTCTGGAATGTCCAAGT

GCAGAAATCAGAGGTACATTTGCAAAGCTTATAGTATTTATTGCACATTTTTCTTTGCAAGATGGATCTTCTCCTTCACCTTTTACATCACCTTTTGCAA

ATCCAGGACCTTATAGTCAG - UNI35611 - ATCTATGACAATTTAAGCTTGAGTGATCATTTACTAAAAGCAGTATTAAGTCTCTTGAGAAGGGAA

GTTTCTGAACATGGGCGACATTTACAACAATATTTCAATTTATTTATAATGTATGCCAGCTTAG - UNI35611 - GTTTGGCAGAAAAGACCCAGCT

TCTAAAACTGAATGTTCCTGCAACCTTTATGCTTGTGTCTTTGGATGAAGGACCAGGCCCTCCAGTTAAATATCAATATGCTGAGTTGAGCAAGTTACAT

TCAGTAGTGTCTCAGCTGATCAGATGTTGCAGTGTCTCATCAAGAATGCAGTCTTCTATCAATG - UNI35611 - GTAACCCCCCTCTTCCAAATCC

ATTTGGTGACCCAAATTTATCACAACCGATAATGCCAATTCAGCAAAATGTGGCTGACATTTTATTTATGAGAACCACTTACATGAAGAAAGTTATTGAA

GACTGCAGTAACTCAGAGGATACAGTCAAATTACTTCTCTTCTGCTGCTGGGAGAATCCCCAGTTTTCATGTTCTGTTCTTAGCGAACTGCTATGGCAG 

GTTGCACATTCACATGCATATGAACTTCAACCATATTTGGATCTACTTTTGCAAATTATTCTGTTTGAGGACTCCTGGCAAGCTCACAG AATTCATAAT

GCACTTAAAGGAATTCCAAATGATCAAGATGGACTGTTTGATACAATCCAGCACTCTAAAAATCACCATCAAAAAAGAGCCTATCAATGTATAAAATGGA

TGGTAACTCTCTTTAACAGTTGTCCTGTTGCCTACCAGATCTTGCAG GGTAATGGAGACCTTAAAAATAAGTGGACTTGGGCTATGGAATGGCTTGGAG

ATGAACTTGAAAGAAAACCATATTCTGGCAATCCTCAATACACTTACAGCAACTGGTCTCCTCCAGTACAAAGCAATGAAACAGCAAATGGTTATTTTTT

AGAGAAATCTCATAGTGCAAAAATGAAACTTACAAAAGCTTGTGATCTGTATCCAGAAGAG GACCCTGATGACCAAGATGCCCTCGATGAACATGTGTC

ACATGCACCACAAGATAGAACATTTTATCTTTATTCACACAGATCTCACTATCAACAG AATTATGTACCTGAACAGCCGTTTTCAGGTCCAGCATCACA

TCACTTGAATAACCCTCAGAAAAATGATAAACCACAAGAAACTCATGAAAGCAATGAAGAAATATCTTCATGTCTAATAAAAGATCAGTAACACAA
Translation
   MTITTRGSPVGENESQGQTSDGQPQPSFQQNQ ISSSDSSNETSPTTPPYEQGQGDAPPQHEEEDPSFPHTDLAKLEDMINR - UNI34600 - R

SRWVVPVLPKGELEVLLEASIDLTKKG - UNI34600 - GLDVKSEACQRFFRDVLTVSFSKILMDEAVSGWKFEIH - UNI34600 - RCIINNT

HRLVELCVAKLSQDWFPFLELLAIALNPHCKFHVYNGARPCESVSSSVQFPEDELFACSPDLHSPK GWLVDLINTFGTLNGFQILHDRFTSGSALNVQT

IAALIK KPFGQCYEFLTQHTLRKYFIPVIEVVPQILQKLTNEELKKETKTEVKNDTISMIIKFLKNLASRIPGQEETVKNLETFRLKMILR RLLQISS

FNGKMNALNEINKVLSSVSYYTHGHGNSEEEWLTVERMT EWIQQNNILSIVLQDSLHQPQYVEKIEKILRFVIKEKALTLQDLNNIWAAQ - UNI341

12 - AGKHEAIVKNVHDLLAKLAWNFSPEQLDHLFDCFK - UNI34112 - ASWTNASKKQREKLLELIRRLAEDDKDGVMAHKVLNLLWNLAHSDD

VPVDIMDLALSAHIKILDYSCSQ - UNI34112 - DRDTQKIQWIDCFIEEFRTNNKWVIPALKQIKEICSLFGEAPQNLS SQTHQSPRVFYRHDLI

SQLQHNHALVTLVAENLAAYMNSIRLYARD DHEDYDPQTVRLGSRYSHVQEVQERLNFLR RFLLKDGQLWLCVSQAKQIWNCLAENAVYFSDREACFM

WYSKLMGDEPDLHPDINKEFFESNVLQLDPSLLTENGMKCFERFFKTVNCREGKLMIKRKIYMMDDLDLIGLDYLWK VVIQSNDDISSRAIDLLKEIYT

SLGPKLQANQ VVIHEDFIQSCFDRLKASYDTLCVLDSEKDNIFSCARQEAIRMVRILTVLREYISEYDSDYHEERMILPMSR RAFRGKHLSFTVRFPN

QGKEVEDLDILSHTNATIGSVRRCILNRMNVNVAHTKIELFIGGELVASEDDRKLVEQLNLKDKS LITAKFIQINSNMPSSPDSSSDSSAGPPGNHSHN

NYRDVSNPEMEKCLPGV - UNI35250 - IMSLQPRYISFLWQVADLGSMLTVPTLRDGARILMKLMPPD - UNI35250 - DSTTLEQLRALCSD

HVNLGERRLGQSLHSLFFGSSASQVLYLTE - UNI35250 - VVYTLLMPAGAPLADISSDFQYHFLKSGGLPLVLSMLIQNNFLPNTDVETRRDAYF

SALKIAKLLLTIVGYGHVQAIAEACQPVADGTDPKTP INQVTHDQAVVLQNALQSIPNPSSECMLRNVSVHLAQQISGL ASRYIPDICVIRAIQKIIW

AAGCGSLELVFSPNEDITETYKM TTSTRSNLEVKDEQVCCEALEVMTLCFALIPTAMDSLNKEKAWQSFVIDLLLYCPSK KTVRQLAQEQFFLICTRC

CMGHRPLLFFITLLFTILG GAANEKGKHSDVYFTLLRRLLTYAYNSNIQVPNVDVLLNDEIDWLKRVR DYIKNTGETNVEDPILEGHLGVTKELLSFQ

SPEKKYHIGCKTGGANLVK ELIDYFIFPASKAYLQYMRSGELPIKQAIPVCGSPATINAGFELLVALAFGCVRNLKQIVNCLTELFYIGTPVTT TCEA

VGEWEYLPPVGPRPPKGFVGLKNAGATCYMNSVIQQLYMIPSIRNSILAIDSIWSDTDDDIFKGEKQDSE NNVDPRDDVFRYPHQFEDKPTLSKVEDRK

EYNIAVLKHLQITFGHLAASQLQYYVPKGFWQQFR RLWGEPVNLREQHDALEFFNSLVDSLDEAFKALGYPTVLSKVLGGSFADQKICQGCPHR RYEC

EESFTTLNVDIRNHQNLLDSLEQYVKGDLLEGANAYHCEKCDKK VDTVKRLLIKKLPSVLTIQLKRFDYDWERECAIKFNDYFEFPRELDMEPYTVAGA

TKLEGDSVNPQTQLIKQNEQSESVIPGSTKYRLVGVLVHSGQANGGHYYSYIIQRNGKDSKRSHWFKFDDGDVTECKMDDDEEMKNQCFGGEYMGEVFDH

MMKRMSYRRQKRWWNAYILFYERMDITDEDDEIITYISELTFTRPHQIMSPAIERSVWKQNVQFLHNQMQFSLEYFQFIKKLLTCNAVYLSPAPG GQDH

LLPEAEDITMISIQLASRFLFTTGFHTKKIIRGPANDW WYDALCILLRHSKNVRFWFVHNVLFNVSNRFSEYLLECPSAEIRGTFAKLIVFIAHFSLQD

GSSPSPFTSPFANPGPYSQ - UNI35611 - IYDNLSLSDHLLKAVLSLLRREVSEHGRHLQQYFNLFIMYASLG - UNI35611 - GLAEKTQLL

KLNVPATFMLVSLDEGPGPPVKYQYAELSKLHSVVSQLIRCCSVSSRMQSSING - UNI35611 - GNPPLPNPFGDPNLSQPIMPIQQNVADILFMR

TTYMKKVIEDCSNSEDTVKLLLFCCWENPQFSCSVLSELLWQ VAHSHAYELQPYLDLLLQIILFEDSWQAHR RIHNALKGIPNDQDGLFDTIQHSKNH

HQKRAYQCIKWMVTLFNSCPVAYQILQ GNGDLKNKWTWAMEWLGDELERKPYSGNPQYTYSNWSPPVQSNETANGYFLEKSHSAKMKLTKACDLYPEE 

DPDDQDALDEHVSHAPQDRTFYLYSHRSHYQQ NYVPEQPFSGPASHHLNNPQKNDKPQETHESNEEISSCLIKDQ

For any suggestions or comments, please send an email to unitrap@crg.es