Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000069045 (Ddx3y)
Chromosomal location
Chr Y: 598038 - 623020 (-)
Description
DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, Y-linked Gene [Source:MGI Symbol;Acc:MGI:1349406]
RefSeq_dna
NM_012008 
RefSeq_peptide
NP_036138.1 
UniGene
Mm.302938 Mm.398499 Mm.405850 Mm.475232 
MGI
MGI:1349406 
Uniprot/SWISSPROT
Q62095 
Uniprot/SPTREMBL
Q3TUR4 Q3U484 
Human Ortholog
ENSG00000067048 (DDX3Y)
Omim 400042 - SERTOLI CELL-ONLY SYNDROME, Y-LINKED  
UniTrap UNI30898
Vector Insertion
Chr Y: 603545 - 606284
Public Clones IST14356H11 (tigm) IST14869D3 (tigm) IST11318G8 (tigm) IST14924G5 (tigm)
IST11005E8 (tigm) IST11294G7 (tigm) IST13027C5 (tigm) IST11480F3 (tigm)
IST12680C9 (tigm) IST13584E3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37727
Vector Insertion
Chr Y: 600238 - 601402
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8980
Vector Insertion
Chr Y: 599811 - 600012
Public Clones RRC298 (baygenomics) RRE374 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000091190
Sequence
AGGAAACAGGTCTACGGTGGCTGTTCCGTGAGAAGTTCTCAATTTTTTTCAGCAATGAGTCAAGTGGCAGCGGAAAGTACGGCCGGCCTGGACCAGCAA 

TTTGTTGGTCTTGACCTGAAATCATCAGATAATCAGAATGGAGGAGGAAATACAGAGAGCA AAGGGCGCTATATACCTCCTCACTTAAGGAACAGAGAA

ACATCTAAAG GGGTCTGTGATAAGGACAGTTCAGGATGGAGCTGTAGTAAAGATAAAGATGCCTACAGCAGTTTTGGATCTCGTGATTCCAGAGGGAAG

CCCAATTATTTCAGTGATCGTGGAAGTGGATCCAGGGGAAG GTTCGATGATCATGGTCGAAATGACTATGATGGTATTGGTGGTCGTGACCGAACTGGA

TTTGGCAAATTTGAACGGAGTGGTCATAGTCGTTGGAGTGACAGATCAGATGAAGATGACTGGTCAAAACCACTTCCACCAAGTGAACGCTTAGAGCA A

GAACTTTTTTCTGGAGGAAACACAGGGATTAACTTTGAGAAATATGATGATATACCAGTAGAAGCAACTGGAAATAATTGTCCTCCTCACATTGAAAAT 

- UNI30898 - TTCAGTGATATTGAGATGGGAGAAATTATCATGGGGAACATTGAACTTACTCGTTACACTCGTCCTACTCCAGTGCAAAAACATGCT

ATTCCAATTATTAAAGAAAAAAGGGACTTAATGGCTTGTGCTCAAACAG - UNI30898 - GGTCTGGAAAAACTGCTGCATTTCTACTACCCATTCT

CAGTCAGATTTATACAGATGGTCCAGGAGAGGCTTTGAAGGCTATGAAG - UNI30898 - GAAAATGGAAGATATGGTCGCCGTAAACAATACCCAA

TCTCCTTGGTGTTAGCCCCAACAAGAGAATTGGCTGTGCAGATCTATGAGGAAGCCAGAAAA TTTTCATACCGATCTAGAGTCCGTCCTTGTGTAGTGT

ATGGTGGTGCTGATACTGTTCAGCAGATTCGGGACTTAGAACGTGGATGCCACTTGTTAGTTGCCACACCAGGACGTCTAGTGGACATGATGGAAAGAGG

AAAGATTGGATTAGATTTCTGCAA ATACTTAGTATTGGATGAAGCTGATAGGATGCTGGATATGGGATTTGAACCTCAAATACGTCGTATAGTTGAGCA

GGACACAATGCCACCAAAGGGGGTTCGTCACACTATGATGTTTAGTGCTACTTTTCCTAAGGAGATACAG ATGCTTGCTCGTGACTTTTTAGATGAATA

TATCTTTCTGGCTGTAGGCAGAGTAGGATCTACTTCTGAGAACATCACACAGAAAGTAGTATGGGTTGAAGAACTAGACAAACGGTCATTTTTACTTGAT

CTCTTAAATGCAACAG GGAAGGATTCATTGACTTTAGTATTTGTGGAGACTAAAAAGGGTGCAGATTCGCTGGAGAACTTCTTATTTCAAGAAAGATAT

GCGTGTACTAGTATTCATGGAGACAGATCACAGAAAGATCGAGAGGAGGCCCTTCACCAGTTTCGCTCAGGGCGAAAGCCAATTTTAGTGGCTACAGCT 

GTGGCAGCAAGAGGTCTAGACATTTCAAATGTGAAACATGTTATCAATTTTGATTTGCCAAGCGATATTGAAGAATATGTGCATCGAATTGGCCGCACAG

GACGTGTAGGAAACCTTG GACTTGCCACCTCTTTTTTCAATGAGAGGAATTTGAACATCACAAAAGATTTGTTAGATCTCCTTGTTGAGGCTAAACAAG

AAGTGCCTTCTTGGTTGGAAAGTATGGCTTATGAACACCACTACAAGGGAAGTAGCCGTGGACGTTCTAAAAG CAGATTCAGTGGAGGATTTGGAGCCA

GAGACTATCGACAGAGCAGTGGTTCTGCAAATGCTGGATTTAATAGTAACCGTGCCAATAGCAGCCGAAGTAGTGGTAGTAGCCACAACAGAGGATTTGG

TGGAG - UNI8980 - GTGGCTATGGAGGTTTCTACAATAATGATGGTTATGGAGGAAATTATAACTCCCAGGCAGTTGACTGGTGGGGCAATTGAAT

TTGTATCATTATTTCATACAGCTAATATGGAAACCACATGTAACTTAGCCAGACTGTATTGTGTAGCTTCAAGAACTTGCAGTACATTACCAGCTGTGAT

TCTTCTAAAAGTTCATGAGAGCTCAAAGTCACAAGAAATTAAGCAACAACCTGTAGCCCTATTCAAAGTTGATGAGAAAAATTTTTGTAACTGGATTAAT

TCACTTCCTGCTTGGTTGTACCCTAAACAGCATTTATAATTTGTGAGTGAGGATCATTTGTTAATGTACTATGACTTTTAACTTTAAACAACTTATTTAA

TGTCCTGTTGTCTCAATAATGCTCAAGATATAAATTGTTTTAATAAGTTAATTGAATTTTGGCTACAAGCAAACCTTGGCACACAAGTGTAATACACCTT

AATAGGAATCAATTCATTGCTAAGTATGATGGTGAATGAACTTATCCTGGATAATAAATTTTTGGTATATGCAGAGTTGTTGGTAAAACTTCTTTTTTAA

GTTTGTAATGTGGCAGACATACAAAACTAAAGTTCTGAACTGCTCACTATATCCTGCATTGACACTTAGAACCTTAAAGTATTAAATATATGATTATATA

TGGTTATATCCTTTATTTTCAAAAGCACTAATGCAGATAACTACAGTGATTCCTCATTTACTGTTTTAAGTAATTTATATTGGCATACTCCTACATGAAA

GTTTAAAATTTTGGTGAAGAATTTGGGATATAAAGTTTAGGTATATTTAATGCCTGCCATGCATAAAAAATGGTAAATTACTAGGTGACTATGGCAATGA

CCAGACCTTATTAAAGCTTTGTTAATTCTGGTCTTTAATGCATGCTAGTGTTGGTGTTTTTTGGTCAAGAGAGTATGAACAGATTATGCAGCAGCAGGCT

TTACTTTTACACAGTCAGGTTTTTCTGTAACAACTATGTTGAAATGTAAAAATAAAATAAAATAAAATAAAAAAGGCTTACATACATACTATGTAAATAT

AAGAATAAAAAATTGAAATTGCTGAGATCTCACAGGTTGGATTTATGTACTAATTATACATGATGGTCAGTACAGTGCAGTTTTCATCTATTTTCGTTGC

ATAGGTTTCCATTGTATTATAGTCATATTTTAATTGGCCAAAAATGATTGTCCCTCACAAAAAATGCCTTTTCCTTTGAGAATTTCCTGGAAAGAATACA

ATAAATTTAAAAACGTAAGTCCTTAAAAATACTATAAGTTGATAAATTTTTCTAAAAGTGCAATAGATTTTCAAGTGTATTGTGCCTTGTATTAAAATTT

TAAAGTAGGTGTACTTGACAGTATTATCAAGGTCATTTGTTACGGTGCTATTTCAATTATAGAAGTTTAGACTGTACATTGCCCATAACTTTTTACAAAG

TACTTATTTTATTGCACATGAAGAGAATTTTATATGTGTATCTTATGTACAAGTCCTTGAAGTTCCAATTGGATATTGTTGATTACAGTGTGTCAAGAAC

TTGGTTCAGAAAATTTTCCATGGACCATAGAATGATAGTTAAGAAAAACTATTTGCAGCCTGAAGTGGTGGCACACGCCTTTAATTGCAGCACTCAGGAG

GCAGAGGCAGGTGGATTTCTGAATTTGTGGCCAGCCTGTTCTGCATAGTGAGTTCCAGGACAGCTAGGGCTCTACAGAGAAACCTTGTCTC
Translation
MSQVAAESTAGLDQQ FVGLDLKSSDNQNGGGNTESK KGRYIPPHLRNRETSKG GVCDKDSSGWSCSKDKDAYSSFGSRDSRGKPNYFSDRGSGSRGR

 RFDDHGRNDYDGIGGRDRTGFGKFERSGHSRWSDRSDEDDWSKPLPPSERLEQ QELFSGGNTGINFEKYDDIPVEATGNNCPPHIEN - UNI30898

 - FSDIEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTG - UNI30898 - GSGKTAAFLLPILSQIYTDGPGEALKAMK - UNI30

898 - ENGRYGRRKQYPISLVLAPTRELAVQIYEEARK FSYRSRVRPCVVYGGADTVQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCK KYLVL

DEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQ MLARDFLDEYIFLAVGRVGSTSENITQKVVWVEELDKRSFLLDLLNATG GKDSL

TLVFVETKKGADSLENFLFQERYACTSIHGDRSQKDREEALHQFRSGRKPILVATA VAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLG GL

ATSFFNERNLNITKDLLDLLVEAKQEVPSWLESMAYEHHYKGSSRGRSKS SRFSGGFGARDYRQSSGSANAGFNSNRANSSRSSGSSHNRGFGGG - U

NI8980 - GGYGGFYNNDGYGGNYNSQAVDWWGN

For any suggestions or comments, please send an email to unitrap@crg.es