Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000069049 (Eif2s3y)
Chromosomal location
Chr Y: 347055 - 365035 (+)
Description
eukaryotic translation initiation factor 2, subunit 3, structural gene Y-linked Gene [Source:MGI (curated);Acc:Eif2s3y-001]
RefSeq_dna
NM_012011 
RefSeq_peptide
NP_036141.1 
UniGene
Mm.250909 
MGI
MGI:1349430 
Uniprot/SWISSPROT
Q9Z0N2 
Uniprot/SPTREMBL
Q9CZT2 Q9D791 
Human Ortholog
not available
Omim not available
UniTrap UNI25279
Vector Insertion
Chr Y: 359918 - 364630
Public Clones IST11354E7 (tigm)
Private Clones OST189396 (lexicon)
Severity of mutation (?) Insertion after 94% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000091194
Sequence
GCAAGATGGCGGGCGGAGAAGCCGGTGTCACTCTCGGGCAGCCGCATCTTTCTCGTCAGGATCTTGCCACTTTG GATGTTACCAAGTTGACTCCGCTTT

CACGTGAAATTATCAGCAGACAAGCCACAATTAATATAG CTGGTAATGAATCTTGTCCTCAACCTCAGACTTCTGAACACCTGGCTGCCATTGAAATTA

TGAAGCTAAAACATATTTTGATTCTGCAAAATAAAATTGATTTGGTGAAAGAAAGCCAGGCTAAAGAACAGTATGAACAGATACTTGCATTTGTACAGG 

GTACAGTAGCCGAAGGAGCTCCTATTATTCCAATTTCTGCTCAGTTAAAATACAATATTGAAGTTGTATGTGAGTATATAGTAAAGAAAATTCCAGTACC

TCTAAGAGACTTTACTTCAGAACCCCGACTTATTG TTATTCGGTCTTTTGATGTTAACAAACCTGGCTGTGAAGTTGATGACCTTAAAGGGGGTGTAGC

TGGTGGTAGTATTTTAAAAGGCGTATTAAAG GTGGGACAAGAGATAGAAGTGAGACCTGGTATTGTTTCTAAAGACGGAGAAGGGAAGCTTATGTGTAA

ACCAATCTTTTCCAAGATTGTATCCCTTTTTGCAGAACACAATGATCTTCAGTATGCTGCTCCAGGTGGTCTTATTG GAGTTGGAACAAAAATTGACCC

AACGTTATGCCGAGCAGATAGAATGGTTGGGCAGGTCCTTGGTGCTGTTGGAGCATTACCTGAGATATTCACAGAGTTAGAAATTTCCTACTTCCTACTG

AGACGGCTCCTAGGTGTACGTACAGAAGGAGACAAGAAAGCAGCAAAA GTTCAAAAGCTATCCAAGAATGAAGTACTCATGGTGAACATAGGGTCCTTG

TCTACAGGAGGCAGAGTTAGTGCAGTCAAGGCAGATTTGGGTAAAATTGTTCTAACCAATCCAGTATGCACAGAAGTAGGAGAAAAAATTGCTCTAAGCC

GACGAGTTGAGAAACACTGGCG - UNI25279 - TTTAATTGGTTGGGGCCAGATAAGAAGAGGCGTGACTATCAAGCCAACAATAGATGATGAATGA

GATGATACATTTGGATGAAACCAGGAATTTTTTCATAACAGTCTTAGAGATATTTTCAAATCTAAAAAGTAGGACATCTAAAGAAGGAAATAAATTTCAC

AGCTTATTATTATATTAGTAAAAATTGCCAGGTTATTTTCATTTTCAGTAGAAAAAAATTGATGTCTGTAAAAAAAAATGACAAACTTCTTGATACATTT

AATCTGCAATTCAACAAATAGTATTATTGTTGTAGCTTGATAGTTAACAACTGTTGCTGTGCACCACTGAACTTACAGTAAAGAAAGTTTTTCTTATGTT

TGAAGGATTGTTACTCTAATAAAAACTTGAAGGCTGGATTC
Translation
MAGGEAGVTLGQPHLSRQDLATL DVTKLTPLSREIISRQATINIA AGNESCPQPQTSEHLAAIEIMKLKHILILQNKIDLVKESQAKEQYEQILAFVQ

G GTVAEGAPIIPISAQLKYNIEVVCEYIVKKIPVPLRDFTSEPRLIV VIRSFDVNKPGCEVDDLKGGVAGGSILKGVLK VGQEIEVRPGIVSKDGEG

KLMCKPIFSKIVSLFAEHNDLQYAAPGGLIG GVGTKIDPTLCRADRMVGQVLGAVGALPEIFTELEISYFLLRRLLGVRTEGDKKAAK VQKLSKNEVL

MVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWR - UNI25279 - RLIGWGQIRRGVTIKPTIDDE
Transcript ENSMUST00000091197
Sequence
GCAAGATGGCGGGCGGAGAAGCCGGTGTCACTCTCGGGCAGCCGCATCTTTCTCGTCAGGATCTTGCCACTTTG GATGTTACCAAGTTGACTCCGCTTT

CACGTGAAATTATCAGCAGACAAGCCACAATTAATATAG GCACAATTGGTCATGTTGCTCATGGAAAATCTACAGTTGTAAAAGCCATTTCTGGTGTTC

ACACTGTCCGATTCAAAAATGAACTAGAAAGGAATATTACCATAAAACTTGGATATGCTAATGCCAAA ATTTATAAGCTTGATGACTCAAGTTGTCCTC

GACCAGAATGTTACAGATCTTGTGGAAGTAGTACACCTGATGAGTTTCCTTCAGATATTCCAGGGACCAAAGGAAACTTCAGACTAGTCAG ACATGTTT

CCTTTGTTGATTGTCCTGGTCATGATATTTTGATGGCAACTATGCTGAATGGGGCAGCAGTGATGGATGCAGCTCTTCTGTTGATAG CTGGTAATGAAT

CTTGTCCTCAACCTCAGACTTCTGAACACCTGGCTGCCATTGAAATTATGAAGCTAAAACATATTTTGATTCTGCAAAATAAAATTGATTTGGTGAAAGA

AAGCCAGGCTAAAGAACAGTATGAACAGATACTTGCATTTGTACAGG GTACAGTAGCCGAAGGAGCTCCTATTATTCCAATTTCTGCTCAGTTAAAATA

CAATATTGAAGTTGTATGTGAGTATATAGTAAAGAAAATTCCAGTACCTCTAAGAGACTTTACTTCAGAACCCCGACTTATTG TTATTCGGTCTTTTGA

TGTTAACAAACCTGGCTGTGAAGTTGATGACCTTAAAGGGGGTGTAGCTGGTGGTAGTATTTTAAAAGGCGTATTAAAG GTGGGACAAGAGATAGAAGT

GAGACCTGGTATTGTTTCTAAAGACGGAGAAGGGAAGCTTATGTGTAAACCAATCTTTTCCAAGATTGTATCCCTTTTTGCAGAACACAATGATCTTCAG

TATGCTGCTCCAGGTGGTCTTATTG GAGTTGGAACAAAAATTGACCCAACGTTATGCCGAGCAGATAGAATGGTTGGGCAGGTCCTTGGTGCTGTTGGA

GCATTACCTGAGATATTCACAGAGTTAGAAATTTCCTACTTCCTACTGAGACGGCTCCTAGGTGTACGTACAGAAGGAGACAAGAAAGCAGCAAAA GTT

CAAAAGCTATCCAAGAATGAAGTACTCATGGTGAACATAGGGTCCTTGTCTACAGGAGGCAGAGTTAGTGCAGTCAAGGCAGATTTGGGTAAAATTGTTC

TAACCAATCCAGTATGCACAGAAGTAGGAGAAAAAATTGCTCTAAGCCGACGAGTTGAGAAACACTGGCG - UNI25279 - TTTAATTGGTTGGGGC

CAGATAAGAAGAGGCGTGACTATCAAGCCAACAATAGATGATGAATGAGATGATACATTTGGATGAAACCAGGAATTTTTTCATAACAGTCTTAGAGATA

TTTTCAAATCTAAAAAGTAGGACATCTAAAGAAGGAAATAAATTTCACAGCTTATTATTATATTAGTAAAAATTGCCAGGTTATTTTCATTTTCAGTAGA

AAAAAATTGATGTCTGTAAAAAAAAATGACAAACTTCTTGATACATTTAATCTGCAATTCAACAAATAGTATTATTGTTGTAGCTTGATAGTTAACAACT

GTTGCTGTGCACCACTGAACTTACAGTAAAGAAAGTTTTTCTTATGTTTGAAGGATTGTTACTCTAATAAAAACTTGAAGGCTGGATTC
Translation
MAGGEAGVTLGQPHLSRQDLATL DVTKLTPLSREIISRQATINIG GTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAK IYKLDDSSC

PRPECYRSCGSSTPDEFPSDIPGTKGNFRLVR RHVSFVDCPGHDILMATMLNGAAVMDAALLLIA AGNESCPQPQTSEHLAAIEIMKLKHILILQNKI

DLVKESQAKEQYEQILAFVQG GTVAEGAPIIPISAQLKYNIEVVCEYIVKKIPVPLRDFTSEPRLIV VIRSFDVNKPGCEVDDLKGGVAGGSILKGVL

K VGQEIEVRPGIVSKDGEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIG GVGTKIDPTLCRADRMVGQVLGAVGALPEIFTELEISYFLLRRLLGVR

TEGDKKAAK VQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWR - UNI25279 - RLIGWGQIRRGVTIKPTI

DDE

For any suggestions or comments, please send an email to unitrap@crg.es