Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000069053 (Ube1y1)
Chromosomal location
Chr Y: 155092 - 180667 (+)
Description
ubiquitin-activating enzyme E1, Chr Y 1 Gene [Source:MGI Symbol;Acc:MGI:98891]
RefSeq_dna
NM_011667 
RefSeq_peptide
NP_035797.1 
UniGene
Mm.399431 Mm.422949 
MGI
MGI:98891 
Uniprot/SWISSPROT
P31254 
Uniprot/SPTREMBL
Q61341 
Human Ortholog
not available
Omim not available
UniTrap UNI38378
Vector Insertion
Chr Y: 170707 - 178410
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115894
Sequence
CTGCTCCGTTCTGGGACCGGATCCTCGAGGAAGAGGAGGTGCGAAGAGAGGGGCAGGGAGCGCACACAGGCACCAATATTGTTAACAATCTGGACCTCTG

TG ATGTCCAGCTCAGTCCTGTCCAAGAAACGCAAAGTGTCTGGACCTGACTCTAGTCTGGATTCTAGTTGGTCTCCTACCTATTCTGTGATGTTTGGCG

TGCCCCCAGGGCCAACCAAC GAAATGTCAAAAAATAAGGAAATGGACATAGATGAAAGCCTTTACTCCCGCCAGCT GTATGTACTCGGCCATGAGGCA

ATGAAGCATCTCCAGGCTTCCAGTGTACTGATATCAGGCCTGCAGGGTCTGGGTGTGGAAATTGCCAAGAATATCATCCTTGGTGGGGTCAAGGCTGTCA

CTCTCCATGATCAGGGCATTGCCCAGTGGGCTGATCTGTCTTCCCAG TTCTGCCTACGTGAGGAAGATATTGGTAAAAACCGAGCTGAGATATCCCAAC

CACGCCTTGCTGAACTCAACAGTTACGTTCCTGTGTTTGCCTACACTGGACCTCTAATTGAGGAGTTCCTTAGTGGTTTTCAG GTAGTGGTTCTTACCA

ACACTCCTTTGGAATATCAGCTGCAGGTGGGTGAATTCTGCCATAGCCACGGAATCAAGCTGGTAGTAGCAGACACTCGGGGCCTAGTTGG ACAACTCT

TCTGTGACTTTGGAGAGGAAATGATTCTCACTGATTCAAATGGAGAACAGCCACTCAGTGCCATGGTTTCAATGATCACTAAG GAGAATCCAGGGATTG

TCACCTGCCTGGAGGACTCCCGGCATGGATTTGAAAGTGGTGACTTTATCTCTTTCACAGAAGTTCAGGGCATGAGTGAACTCAATGGCATTGGTCCCAT

AGAGATCAAAGTTCTGG GTCCCTATACCTTTAGTATCTGTGATACCTCCAGCTTCTCTGAGTACATCCGTGGAGGCATTGTCAGTCAAGTGAAAGTACC

TCGGAAGATCAATTTT AAACCCCTACTTGCCTCGCTGGCAGAGCCAGAGTTTGTGGTCACAGATTTTGCTAAGTGCTGTCATCCTGCTCAGCTCCACAT

TGGCTTCCAGGCCCTGCATCAGTTCTGTACTCAGCACAGCAGGCCTCCTCGGCCCCATAATGAG GAGGATGCTGAGGAATTGGTGACCTTAGCCCAATC

TGTGAATGCTCAAGCTTTGCCAGCAGTTCAGCAGGATTGCCTGGACATCGACCTTATCCGGAAGTTGGCCTATGTAGCAGCTGGGGACCTGGCACCCATG

AATGCCTTTTTTGGTGGTTTGGCTGCCCAGGAGGTCATGAAG GCTTGTTCTGGAAAGTTTATGCCCATTAGGCAGTGGCTGTACTTTGATGCCCTTGAA

TGTCTCCCAGAGCACAGAGTGGCCTTCATGGAAGATAAGTGCCTGCCA CACCAGAACCGTTATGATGGGCAAGTGGCTGTATTTGGATCAGACCTACAA

GAGAAGCTTGGCAAGCAGAAATACTTCCTG GTAGGTGCAGGTGCCATTGGCTGTGAGCTGCTCAAGAACTTTGCCATGATTGGCCTCGGCTGTGGGGAG

GATGGAGAAATCACAGTTACAGACATGGACACCATTGAGAAGTCAAACCTGAACAGGCAGTTTCTCTTCCGTCCCTGGGACATCACA AAATTAAAGTCT

GAGACTGCTGCTGCAGCAGTGCGTGACATAAATCCACACATCAGGATATTCAGCCACCAGAATCGAGTAGGCCCAGAGACAGAACACGTCTATGATGATG

ACTTCTTCCAAAAGCTGGATGGTGTGGCCAATGCCCTAGACAATGTGGATGCTC GATTATACGTGGACCGCCGTTGTGTTTACTATCGTAAGCCTCTGC

TGGAATCAGGCACGCTGGGCACCAAGGGCAACGTGCAGGTGGTTGTTCCCTTCTTGACAGAATCTTACAGCTCAAGCCAGGACCCACCTGAGAAATCCAT

CCCCATCTGCACACTGAAGAACTTCCCTAATGCCATTGAGCACACCGTGCAG TGGGCTCGGGATGAGTTTGAAGGGCTCTTCAAGCAGTCAGCTGAAAA

TGTTAACCAATACCTCAC GGACCCCAAGTTCATGGAGCGGACACTGCAGCTAGCCGGCACCCAGCCTTTGGAAGTACTGGAGGCCATACACTGCAGCCT

GGTCCTGCAGAGGCCACAGACTTGGGCCGACTGTGTGACTTGGGCCTACCAGCACTGGCACACCCAGTATTCTCACAACATCCAGCAGTTGCTGCACAAC

TTCCCTCCAGCACAG CTTACGAGCTCTGGAGCACTTTTTTGGTCAGGACCAAAACGCTGTCCACATCCTCTCACCTTTGACATAAACAAT CCCCTGCA

TCTGGATTATGTGATGGCTGCTGCCAACCTGTTTGCTCAGACATACGGACTAGGAGGGTCCCAGGACTGTGCTGTGGTGGCCAAACTCCTGCAGTCTCTG

CCAGTCCCCAAGTTTGCTCCCAAGTCTGGCATCAGGATCCATGTTTCTGAGCAGGAGCTGCAGAGTACCAGTGCCACCACCATTG ATGACAGCCACCTG

GAGGAACTCAAGACTGCACTTCCTACTCCAGACAAGCTGCTTGGATTCAAGATGTACCCCATTGACTTTGAGAAG - UNI38378 - GATGACGACAG

CAACTTTCACATGGATTTCATTGTGGCAGCATCCAACCTCCGAGCAGAAAACTATGGCATTTCCCCAGCAGACCGGCATAAG AGCAAACTGATTGCAGG

CAAGATCATCCCAGCCATTGCAACCACCACATCTGCTATAGTTGGCCTTGTGTGTCTGGAGCTGTACAAGGTGGTTCAGGGCCACCAACAACTGGAGTCT

TATAAAAACAGTTTTATCAACTTGGCTCTGCCTTTGTTTAGCTTTTCTGCACCTCTGGCTCCAGAGTGTCATCAG TACTATGATCAAGAGTGGACACTG

TGGGATCGCTTTGATGTGCAAGGACTGCAACCTAGCGGTGAGGAGATGACCTTGAAGCAGTTTCTAGACTACTTTAAG ACAGAGCACAAGCTGGAAGTC

ATCATGCTGTCCCAGGGTGTGTCCATGCTCTATTCTGTCTTTATGCCAGCCAGCAAGCTCAAAGAACGGTTGGATCAGCC GATGACAGAGATTGTGAGC

TGTGTGTCAAAGCAAAAACTGGGCCATCATGTGAAGTCACTTGTGTTTGAGCTGTGCTGCAACAGTGACAGTGGAGACGACATAGAGGTTCCTTATGTAC

GATACATCATCCGCTGATCTCTTACTGACTCCGTTCTTTCAGATCTCTCAGTCTATATCAAAACCTTTCTAGTTATGAGGAAACCTCAGTTTGAACCTCC

TTGTTCCTAAGAACTTTTTAGTGCTGTTTTTACATTGTTAAGAACTGAAATTCATAATAATAAATTTTCAGCCTGTGAATAGTAGAGTGTCTTCCTCTCC

TTTTAGGTGTGGGTGTGCTGCTGTCCCTAGGAAGAAATGGACACCTTATCCTAAACTGTAATTCTTTTTTTTTTTTCAAAAACAATTTTATTAGATATTT

TCTTCATTTACATTTCAAATGCTATCCCCAAAGTCCCATATACCTTCCCCCCTGCTGTGCTCCCCAACCCACCCACTTCTGTTTCCTAGCTCTGGCATTC

CACTGTACTGGGGCATATAATCTAGGCCATCCTCTGCTACATATGCAACTAGAGACACAAGCTCTGGGGGTACTGGTTAGTTCATACTGTTGTTCCTCCT

ATAGGGTTGCAGACCCCTTTAGCTCCTTGGGTATTTTCTCTAGCTCCTTCATTGGAGGGCATGTGTTCCATCCAATAGATGACTGTGAGCATTCACTTCT

GTATTTGTCAGGCACTGGCATTGCCTCACAAGAGAGAGCTATATCAGGGTCCTGTCAGCAAAATCTTGCTGGCATATGCAATAGTGTCTGGGTTTGGTGG

CTGTTTATGGGATGGATCC
Translation
 MSSSVLSKKRKVSGPDSSLDSSWSPTYSVMFGVPPGPTN EMSKNKEMDIDESLYSRQL LYVLGHEAMKHLQASSVLISGLQGLGVEIAKNIILGGVK

AVTLHDQGIAQWADLSSQ FCLREEDIGKNRAEISQPRLAELNSYVPVFAYTGPLIEEFLSGFQ VVVLTNTPLEYQLQVGEFCHSHGIKLVVADTRGLV

G GQLFCDFGEEMILTDSNGEQPLSAMVSMITK ENPGIVTCLEDSRHGFESGDFISFTEVQGMSELNGIGPIEIKVLG GPYTFSICDTSSFSEYIRGG

IVSQVKVPRKINF KPLLASLAEPEFVVTDFAKCCHPAQLHIGFQALHQFCTQHSRPPRPHNE EDAEELVTLAQSVNAQALPAVQQDCLDIDLIRKLAY

VAAGDLAPMNAFFGGLAAQEVMK ACSGKFMPIRQWLYFDALECLPEHRVAFMEDKCLP HQNRYDGQVAVFGSDLQEKLGKQKYFL VGAGAIGCELLK

NFAMIGLGCGEDGEITVTDMDTIEKSNLNRQFLFRPWDIT KLKSETAAAAVRDINPHIRIFSHQNRVGPETEHVYDDDFFQKLDGVANALDNVDAR RL

YVDRRCVYYRKPLLESGTLGTKGNVQVVVPFLTESYSSSQDPPEKSIPICTLKNFPNAIEHTVQ WARDEFEGLFKQSAENVNQYLT TDPKFMERTLQL

AGTQPLEVLEAIHCSLVLQRPQTWADCVTWAYQHWHTQYSHNIQQLLHNFPPAQ LTSSGALFWSGPKRCPHPLTFDINN PLHLDYVMAAANLFAQTYG

LGGSQDCAVVAKLLQSLPVPKFAPKSGIRIHVSEQELQSTSATTID DDSHLEELKTALPTPDKLLGFKMYPIDFEK - UNI38378 - DDDSNFHMD

FIVAASNLRAENYGISPADRHK SKLIAGKIIPAIATTTSAIVGLVCLELYKVVQGHQQLESYKNSFINLALPLFSFSAPLAPECHQ YYDQEWTLWDRF

DVQGLQPSGEEMTLKQFLDYFK TEHKLEVIMLSQGVSMLYSVFMPASKLKERLDQP PMTEIVSCVSKQKLGHHVKSLVFELCCNSDSGDDIEVPYVRY

IIR
Transcript ENSMUST00000091208
Sequence
CTCATTTTGTGGAAGGAGTTTCCCGAGAGAAACTGGCTGCTGGCCAGGGACTTGAAGGTGGAGGCTGCTCCGTTCTGGGACCGGATCCTCGAGGAAGAGG

AG ATGTCCAGCTCAGTCCTGTCCAAGAAACGCAAAGTGTCTGGACCTGACTCTAGTCTGGATTCTAGTTGGTCTCCTACCTATTCTGTGATGTTTGGCG

TGCCCCCAGGGCCAACCAAC GAAATGTCAAAAAATAAGGAAATGGACATAGATGAAAGCCTTTACTCCCGCCAGCT GTATGTACTCGGCCATGAGGCA

ATGAAGCATCTCCAGGCTTCCAGTGTACTGATATCAGGCCTGCAGGGTCTGGGTGTGGAAATTGCCAAGAATATCATCCTTGGTGGGGTCAAGGCTGTCA

CTCTCCATGATCAGGGCATTGCCCAGTGGGCTGATCTGTCTTCCCAG TTCTGCCTACGTGAGGAAGATATTGGTAAAAACCGAGCTGAGATATCCCAAC

CACGCCTTGCTGAACTCAACAGTTACGTTCCTGTGTTTGCCTACACTGGACCTCTAATTGAGGAGTTCCTTAGTGGTTTTCAG GTAGTGGTTCTTACCA

ACACTCCTTTGGAATATCAGCTGCAGGTGGGTGAATTCTGCCATAGCCACGGAATCAAGCTGGTAGTAGCAGACACTCGGGGCCTAGTTGG ACAACTCT

TCTGTGACTTTGGAGAGGAAATGATTCTCACTGATTCAAATGGAGAACAGCCACTCAGTGCCATGGTTTCAATGATCACTAAG GAGAATCCAGGGATTG

TCACCTGCCTGGAGGACTCCCGGCATGGATTTGAAAGTGGTGACTTTATCTCTTTCACAGAAGTTCAGGGCATGAGTGAACTCAATGGCATTGGTCCCAT

AGAGATCAAAGTTCTGG GTCCCTATACCTTTAGTATCTGTGATACCTCCAGCTTCTCTGAGTACATCCGTGGAGGCATTGTCAGTCAAGTGAAAGTACC

TCGGAAGATCAATTTT AAACCCCTACTTGCCTCGCTGGCAGAGCCAGAGTTTGTGGTCACAGATTTTGCTAAGTGCTGTCATCCTGCTCAGCTCCACAT

TGGCTTCCAGGCCCTGCATCAGTTCTGTACTCAGCACAGCAGGCCTCCTCGGCCCCATAATGAG GAGGATGCTGAGGAATTGGTGACCTTAGCCCAATC

TGTGAATGCTCAAGCTTTGCCAGCAGTTCAGCAGGATTGCCTGGACATCGACCTTATCCGGAAGTTGGCCTATGTAGCAGCTGGGGACCTGGCACCCATG

AATGCCTTTTTTGGTGGTTTGGCTGCCCAGGAGGTCATGAAG GCTTGTTCTGGAAAGTTTATGCCCATTAGGCAGTGGCTGTACTTTGATGCCCTTGAA

TGTCTCCCAGAGCACAGAGTGGCCTTCATGGAAGATAAGTGCCTGCCA CACCAGAACCGTTATGATGGGCAAGTGGCTGTATTTGGATCAGACCTACAA

GAGAAGCTTGGCAAGCAGAAATACTTCCTG GTAGGTGCAGGTGCCATTGGCTGTGAGCTGCTCAAGAACTTTGCCATGATTGGCCTCGGCTGTGGGGAG

GATGGAGAAATCACAGTTACAGACATGGACACCATTGAGAAGTCAAACCTGAACAGGCAGTTTCTCTTCCGTCCCTGGGACATCACA AAATTAAAGTCT

GAGACTGCTGCTGCAGCAGTGCGTGACATAAATCCACACATCAGGATATTCAGCCACCAGAATCGAGTAGGCCCAGAGACAGAACACGTCTATGATGATG

ACTTCTTCCAAAAGCTGGATGGTGTGGCCAATGCCCTAGACAATGTGGATGCTC GATTATACGTGGACCGCCGTTGTGTTTACTATCGTAAGCCTCTGC

TGGAATCAGGCACGCTGGGCACCAAGGGCAACGTGCAGGTGGTTGTTCCCTTCTTGACAGAATCTTACAGCTCAAGCCAGGACCCACCTGAGAAATCCAT

CCCCATCTGCACACTGAAGAACTTCCCTAATGCCATTGAGCACACCGTGCAG TGGGCTCGGGATGAGTTTGAAGGGCTCTTCAAGCAGTCAGCTGAAAA

TGTTAACCAATACCTCAC GGACCCCAAGTTCATGGAGCGGACACTGCAGCTAGCCGGCACCCAGCCTTTGGAAGTACTGGAGGCCATACACTGCAGCCT

GGTCCTGCAGAGGCCACAGACTTGGGCCGACTGTGTGACTTGGGCCTACCAGCACTGGCACACCCAGTATTCTCACAACATCCAGCAGTTGCTGCACAAC

TTCCCTCCAGCACAG CTTACGAGCTCTGGAGCACTTTTTTGGTCAGGACCAAAACGCTGTCCACATCCTCTCACCTTTGACATAAACAAT CCCCTGCA

TCTGGATTATGTGATGGCTGCTGCCAACCTGTTTGCTCAGACATACGGACTAGGAGGGTCCCAGGACTGTGCTGTGGTGGCCAAACTCCTGCAGTCTCTG

CCAGTCCCCAAGTTTGCTCCCAAGTCTGGCATCAGGATCCATGTTTCTGAGCAGGAGCTGCAGAGTACCAGTGCCACCACCATTG ATGACAGCCACCTG

GAGGAACTCAAGACTGCACTTCCTACTCCAGACAAGCTGCTTGGATTCAAGATGTACCCCATTGACTTTGAGAAG - UNI38378 - GATGACGACAG

CAACTTTCACATGGATTTCATTGTGGCAGCATCCAACCTCCGAGCAGAAAACTATGGCATTTCCCCAGCAGACCGGCATAAG AGCAAACTGATTGCAGG

CAAGATCATCCCAGCCATTGCAACCACCACATCTGCTATAGTTGGCCTTGTGTGTCTGGAGCTGTACAAGGTGGTTCAGGGCCACCAACAACTGGAGTCT

TATAAAAACAGTTTTATCAACTTGGCTCTGCCTTTGTTTAGCTTTTCTGCACCTCTGGCTCCAGAGTGTCATCAG TACTATGATCAAGAGTGGACACTG

TGGGATCGCTTTGATGTGCAAGGACTGCAACCTAGCGGTGAGGAGATGACCTTGAAGCAGTTTCTAGACTACTTTAAG ACAGAGCACAAGCTGGAAGTC

ATCATGCTGTCCCAGGGTGTGTCCATGCTCTATTCTGTCTTTATGCCAGCCAGCAAGCTCAAAGAACGGTTGGATCAGCC GATGACAGAGATTGTGAGC

TGTGTGTCAAAGCAAAAACTGGGCCATCATGTGAAGTCACTTGTGTTTGAGCTGTGCTGCAACAGTGACAGTGGAGACGACATAGAGGTTCCTTATGTAC

GATACATCATCCGCTGATCTCTTACTGACTCCGTTCTTTCAGATCTCTCAGTCTATATCAAAACCTTTCTAGTTATGAGGAAACCTCAGTTTGAACCTCC

TTGTTCCTAAGAACTTTTTAGTGCTGTTTTTACATTGTTAAGAACTGAAATTCATAATAATAAATTTTCAGCCTGTG
Translation
 MSSSVLSKKRKVSGPDSSLDSSWSPTYSVMFGVPPGPTN EMSKNKEMDIDESLYSRQL LYVLGHEAMKHLQASSVLISGLQGLGVEIAKNIILGGVK

AVTLHDQGIAQWADLSSQ FCLREEDIGKNRAEISQPRLAELNSYVPVFAYTGPLIEEFLSGFQ VVVLTNTPLEYQLQVGEFCHSHGIKLVVADTRGLV

G GQLFCDFGEEMILTDSNGEQPLSAMVSMITK ENPGIVTCLEDSRHGFESGDFISFTEVQGMSELNGIGPIEIKVLG GPYTFSICDTSSFSEYIRGG

IVSQVKVPRKINF KPLLASLAEPEFVVTDFAKCCHPAQLHIGFQALHQFCTQHSRPPRPHNE EDAEELVTLAQSVNAQALPAVQQDCLDIDLIRKLAY

VAAGDLAPMNAFFGGLAAQEVMK ACSGKFMPIRQWLYFDALECLPEHRVAFMEDKCLP HQNRYDGQVAVFGSDLQEKLGKQKYFL VGAGAIGCELLK

NFAMIGLGCGEDGEITVTDMDTIEKSNLNRQFLFRPWDIT KLKSETAAAAVRDINPHIRIFSHQNRVGPETEHVYDDDFFQKLDGVANALDNVDAR RL

YVDRRCVYYRKPLLESGTLGTKGNVQVVVPFLTESYSSSQDPPEKSIPICTLKNFPNAIEHTVQ WARDEFEGLFKQSAENVNQYLT TDPKFMERTLQL

AGTQPLEVLEAIHCSLVLQRPQTWADCVTWAYQHWHTQYSHNIQQLLHNFPPAQ LTSSGALFWSGPKRCPHPLTFDINN PLHLDYVMAAANLFAQTYG

LGGSQDCAVVAKLLQSLPVPKFAPKSGIRIHVSEQELQSTSATTID DDSHLEELKTALPTPDKLLGFKMYPIDFEK - UNI38378 - DDDSNFHMD

FIVAASNLRAENYGISPADRHK SKLIAGKIIPAIATTTSAIVGLVCLELYKVVQGHQQLESYKNSFINLALPLFSFSAPLAPECHQ YYDQEWTLWDRF

DVQGLQPSGEEMTLKQFLDYFK TEHKLEVIMLSQGVSMLYSVFMPASKLKERLDQP PMTEIVSCVSKQKLGHHVKSLVFELCCNSDSGDDIEVPYVRY

IIR

For any suggestions or comments, please send an email to unitrap@crg.es