Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000069170 (Gpr98)
Chromosomal location
Chr 13: 81234067 - 81772143 (-)
Description
G protein-coupled receptor 98 Gene [Source:MGI Symbol;Acc:MGI:1274784]
RefSeq_dna
NM_054053 
RefSeq_peptide
NP_473394.3 
UniGene
Mm.288694 
MGI
MGI:1274784 
Uniprot/SWISSPROT
Q8VHN7 
Uniprot/SPTREMBL
Q8BPQ5 Q8C1E5 Q91ZS2 
Human Ortholog
ENSG00000164199 (GPR98)
Omim 604352 - FEBRILE CONVULSIONS, FAMILIAL, 4  605472 - USHER SYNDROME, TYPE IIC  
UniTrap UNI34617
Vector Insertion
Chr 13: 81734419 - 81772144
Public Clones (sanger) IST10078F10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23109
Vector Insertion
Chr 13: 81734361 - 81734419
Public Clones not available
Private Clones OST276149 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38472
Vector Insertion
Chr 13: 81245901 - 81294276
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000099351
Sequence
AATATTGAGAACAAAA - UNI23109 - - UNI34617 - TAGGGATGATCTCTTCATTTTTACTAGTATACCTGTCAACCTTGTTCATCTCTTTTG

TATTTGGAGAAGCGGAAATAAGATTCACTGGACAGACAGAGTTCTTCGTTAATGAGACAAGTACCACAGTTATTCGTCTTGTCATTGAGAGGATAGGCGA

GCCCGCAAATGTTACTGCCATTGTGTCG CTGAGCGGAGAAGACACTGGTGACTTTTTTGATACATACGCCGCAGCGTTTATCCCTGCCAGAGGAACAAA

CAGGACAGTGTACATAGCAGTATGTGACGACGATCTTCCGGAGCCTGATGAAACCTTCACATTTCACTTGACATTACAG AAACCCTCAGCAAATGTGAA

ACTTGGATGGCCAAGGGCTGCTTCTGTGACAATCCTATCAAATGACAATGCATTTGGAATCATTTCCTTTAGTACG CCCTCATCAATCTCGGTGATTGA

GCCAAGGAGCAGAAATGCATCTGTACCTCTTACTCTCATCAGAGAAAAAGGGACCTATGGAATGGTCACCGTGACTTTTGAT GTATCAGGTGGCCCAAA

TCCCCCTGAGGAAGACTTGAATCCAGTTAGAGGAAATATCACCTTCCCACCTGGCAGAGCAACTGTGATTTACAACGTGACAGTTCTTGATGATGAG GT

ACCAGAAAATGATGAACTATTTTTGATTCAACTGAGAAGTGTAGAAGGAGGAGCAGAGATTAATGCTTCTAGGAGCTCGGTTGAAATCATTGTGAAGAAA

AATGATAGTCCTGTGAACTTCATGCAGAGTGTTTACGTGGTTCCCGAGGACGACCACGTACTCACTATTCCCGTGCTTCGTGGGAAGGATAGTGATGGAA

ATCTCATTGGATCTGATGAAACCCAAGTGTCAATCAGATACAAAGTAATGACTTGGGATTCAACAGCACATGCCCAGCAAAACGTTGACTTTATTGATCT

TCAGCCGGATACTACTCTTGTCTTTCCCCCTTTTGTTCATGAATCACACCTGAAATTTCAGATAATCGATGACCTTATACCCGAGATAGCTGAGTCATTT

CACATCATGTTACTAAAGAACACCTTACAGGGAGATGCTGTGCTAATGGGCCCTTCTACAGTACAGGTCACCATTAAGCCAAATGACAAGCCCTATGGAG

TTCTTTCATTCAATAGTATTTTGTTTGAAAGACCAGTTATAATTGATGAAGATACAGCATCCAG TTCTAGATTTGAAGAAATTGCAGTGGTTAGAAATG

GTGGCACACATGGGAATGTCTCTGTGAGCTGGGTGTTGACACGGAACAGCAGTGATCCCTCACCAGTGACCGCAGACATCACCCCTGCTTCTGGGACTCT

GCAGTTCGCACAAGGGCAGATGCTGGCGCCAATTTCTCTAGTGGTCTTTGACGATGATCTTCCAGAAGAGGCTGAAGCTTACTTACTTACAATCTTGCCT

CACACCATACAAGGAGGCGCTGAAGTGAGCGAGCCAGCGCAG CTTCTGTTCTACATTCAGGACAGCGATAATGTTTATGGAGAAATAGCCTTTTTTCCT

GGGGAAAGCCAGAAGATTGAAAGCAGCCCTAGTGAGCGATCCTTATCCCTGAGTTTGGCGAGACGTGGGGGAAGTAAAGGAGACGTGAGGGTGATTTATT

CTGCACTTTATATTCCTGCTGGAGCTATGGACCCCTTGCGAGCAAAAGATGGCATCTTAAATACATCTAGGAGAAGCAGCCTCCTTTTCCCAGAACAGAA

CCAACAAGTTTCTATAAAATTACCGATAAGGAATGATGCATTCCTCCAGAATGGGGCCCACTTCCTAGTGCAG TTGGAAGCTGTGGTGTTGGTGAACAT

ATTCCCTCCGATTCCACCAGTAAGTCCCAGATTCGGAGAAATCAGAAATATTTCATTACTGGTTACCCCAGCCATTGCAAATGGAGAAATTGGCTTTCTT

AGCAACCTTCCAATTATTTTGCATGAACCCAAAGATTCTTCTGCTGAGGTG GTATCTATCCCCTTGCATCGAGATGGAACTGATGGCCAGGCTACCGTG

TACTGGAGTTTGCGGCCCTCTGGCTTTAATTCAAAAGCAGTGACTTTGGATGACGCAGGTCCTTTTAATGGCTCTGTTGTGTTTTTATCTGGACAAAACG

AAACATCAATCAACATTACTGTCAAAGGCGATGACATACCGGAGTTGAATGAAACTGTAACCCTTTCTCTAGATAG GGTGAGCGTGGACAGTGACGTCC

TAAAATCAGGCTATACTAGCCGAGACTTGATTATTTTGGAAAATGATGACCCTGGAGGCATTTTTGAATTTTCTTATGATTCTAGAGGACCCTATGTTAT

AAAA GAAGGAGATGCCGTGGAGCTCCGGATTACTCGGTCCAGGGGGTCGCTTGTTAAACAGTTCCTCCGCTTTCACGTGGAACCCAGAGAGAGCAATGA

ATTCTATGGAAACATGGGGGTGCTAGAATTCACCCCAGGAGAACGGGAAGTAGTGATCACCCTCCTCACCAGACTGGATGGCACACCAGAG TTGGACGA

GCACTTCTGGGTGATCCTCAGCAGCCATGGTGAGAGAGAGAGCAAGCTGGGCTGTGCTACACTCGTCAACATAACGATTCTCAAAAACGACTATCCTCAT

GGGATTATAGAATTTGTTTCCGATGGTTTGAGTGCATCGATAAAAGAGAGCAAAGGGGAGGATATCTATCATG CTGTTTATGGTGTAATACGAACTCGA

GGCAACTTTGGTGCTGTTAATGTATCATGGATGGTTAGTCCAGACTTTACGCAAGATGTATTTCCTGTGCAAGGAACTGTTTGTTTTGGAGACCAAGAAT

TTTTTAAAAACATCACTGTCTACTCCCTTGTAGATGAA ATTCCAGAGGAGATGGAAGAATTCACCATTATCCTACTTAATGCCACTGGAGGAGCTCAAA

CAGGGATCAGGACAACTGCCTCCCTGAGGATTCTCAGGAACGATGACCCCGTTTACTTTGCAG AGCCTTGTGTTTTGAGGGTCCAGGAGGGTGAGACTG

CCAACTTTACAGTTCTCAGAAATGGATCTGTTGACGGGGCCTGCACTGTCCAGTATGCTACCGTGGATGGGAAGGCTTCAGGAGAAGAGGGAGACTTCGC

TCCTGTGGAGAAGGGAGAAACTCTTGTGTTTGAAGTTGGAAGCAGAGAGCAGAGTATATCTGTACATGTCAAGGATGACGGAATCCCAGAAACAGATGAG

CCTTTTTATATAGTCCTGTTCAACTCAACAG GTGACACAGTGGTTTATGAGTACGGGGTAGCTACAGTCATAATTGAAGCCAACGATGACCCAAATGGT

GTTTTCTCTCTGGAGCCCATAGACAAAGCAGTGGAAGAAGGAAAGACAAATGCATTTTG GATTTTACGGCACCGAGGACACTTCGGCAATGTTTCTGTG

GCTTGGCAGCTGTTCCAGAATGCTTCTCTGCAGCCTGGACAAGAGTTCTATGAAACATCAGGGACTGTTAACTTCACAGATGGAGAAGAAACAAAACCAG

TCATTCTCCGTGCTTTCCCAGATAGGATTCCTGAATTCAATGAATTTTATATTCTAAGGCTTGTAAATATTTCAGGTACCAACCTTTCCCATCTCTAATG

TTAACATCAAAACTTTATAGATTATACTTAAATAGAATTGTGTACAAAACC
Translation
NIENKI - UNI23109 - - UNI34617 - IGMISSFLLVYLSTLFISFVFGEAEIRFTGQTEFFVNETSTTVIRLVIERIGEPANVTAIVS LSGE

DTGDFFDTYAAAFIPARGTNRTVYIAVCDDDLPEPDETFTFHLTLQ KPSANVKLGWPRAASVTILSNDNAFGIISFST PSSISVIEPRSRNASVPLTL

IREKGTYGMVTVTFD VSGGPNPPEEDLNPVRGNITFPPGRATVIYNVTVLDDE VPENDELFLIQLRSVEGGAEINASRSSVEIIVKKNDSPVNFMQSV

YVVPEDDHVLTIPVLRGKDSDGNLIGSDETQVSIRYKVMTWDSTAHAQQNVDFIDLQPDTTLVFPPFVHESHLKFQIIDDLIPEIAESFHIMLLKNTLQG

DAVLMGPSTVQVTIKPNDKPYGVLSFNSILFERPVIIDEDTASS SSRFEEIAVVRNGGTHGNVSVSWVLTRNSSDPSPVTADITPASGTLQFAQGQMLA

PISLVVFDDDLPEEAEAYLLTILPHTIQGGAEVSEPAQ LLFYIQDSDNVYGEIAFFPGESQKIESSPSERSLSLSLARRGGSKGDVRVIYSALYIPAGA

MDPLRAKDGILNTSRRSSLLFPEQNQQVSIKLPIRNDAFLQNGAHFLVQ LEAVVLVNIFPPIPPVSPRFGEIRNISLLVTPAIANGEIGFLSNLPIILH

EPKDSSAEV VSIPLHRDGTDGQATVYWSLRPSGFNSKAVTLDDAGPFNGSVVFLSGQNETSINITVKGDDIPELNETVTLSLDR RVSVDSDVLKSGYT

SRDLIILENDDPGGIFEFSYDSRGPYVIK EGDAVELRITRSRGSLVKQFLRFHVEPRESNEFYGNMGVLEFTPGEREVVITLLTRLDGTPE LDEHFWV

ILSSHGERESKLGCATLVNITILKNDYPHGIIEFVSDGLSASIKESKGEDIYHA AVYGVIRTRGNFGAVNVSWMVSPDFTQDVFPVQGTVCFGDQEFFK

NITVYSLVDE IPEEMEEFTIILLNATGGAQTGIRTTASLRILRNDDPVYFAE EPCVLRVQEGETANFTVLRNGSVDGACTVQYATVDGKASGEEGDFA

PVEKGETLVFEVGSREQSISVHVKDDGIPETDEPFYIVLFNSTG GDTVVYEYGVATVIIEANDDPNGVFSLEPIDKAVEEGKTNAFW WILRHRGHFGN

VSVAWQLFQNASLQPGQEFYETSGTVNFTDGEETKPVILRAFPDRIPEFNEFYILRLVNISGTNLSHL
Transcript ENSMUST00000109565
Sequence
ATGTGCTTGCCTTCTCTTCGCCCTTCCCACTGTTCTTTCTGTGTTGACAGGGTGGAAACTGAAAGATTTGTTGTGTATTTTGG GGTGAGCGTGGACAGT

GACGTCCTAAAATCAGGCTATACTAGCCGAGACTTGATTATTTTGGAAAATGATGACCCTGGAGGCATTTTTGAATTTTCTTATGATTCTAGAGGACCCT

ATGTTATAAAA GAAGGAGATGCCGTGGAGCTCCGGATTACTCGGTCCAGGGGGTCGCTTGTTAAACAGTTCCTCCGCTTTCACGTGGAACCCAGAGAGA

GCAATGAATTCTATGGAAACATGGGGGTGCTAGAATTCACCCCAGGAGAACGGGAAGTAGTGATCACCCTCCTCACCAGACTGGATGGCACACCAGAG T

TGGACGAGCACTTCTGGGTGATCCTCAGCAGCCATGGTGAGAGAGAGAGCAAGCTGGGCTGTGCTACACTCGTCAACATAACGATTCTCAAAAACGACTA

TCCTCATGGGATTATAGAATTTGTTTCCGATGGTTTGAGTGCATCGATAAAAGAGAGCAAAGGGGAGGATATCTATCATG CTGTTTATGGTGTAATACG

AACTCGAGGCAACTTTGGTGCTGTTAATGTATCATGGATGGTTAGTCCAGACTTTACGCAAGATGTATTTCCTGTGCAAGGAACTGTTTGTTTTGGAGAC

CAAGAATTTTTTAAAAACATCACTGTCTACTCCCTTGTAGATGAA ATTCCAGAGGAGATGGAAGAATTCACCATTATCCTACTTAATGCCACTGGAGGA

GCTCAAACAGGGATCAGGACAACTGCCTCCCTGAGGATTCTCAGGAACGATGACCCCGTTTACTTTGCAG AGCCTTGTGTTTTGAGGGTCCAGGAGGGT

GAGACTGCCAACTTTACAGTTCTCAGAAATGGATCTGTTGACGGGGCCTGCACTGTCCAGTATGCTACCGTGGATGGGAAGGCTTCAGGAGAAGAGGGAG

ACTTCGCTCCTGTGGAGAAGGGAGAAACTCTTGTGTTTGAAGTTGGAAGCAGAGAGCAGAGTATATCTGTACATGTCAAGGATGACGGAATCCCAGAAAC

AGATGAGCCTTTTTATATAGTCCTGTTCAACTCAACAG GTGACACAGTGGTTTATGAGTACGGGGTAGCTACAGTCATAATTGAAGCCAACGATGACCC

AAATGGTGTTTTCTCTCTGGAGCCCATAGACAAAGCAGTGGAAGAAGGAAAGACAAATGCATTTTG GATTTTACGGCACCGAGGACACTTCGGCAATGT

TTCTGTGGCTTGGCAGCTGTTCCAGAATGCTTCTCTGCAGCCTGGACAAGAGTTCTATGAAACATCAGGGACTGTTAACTTCACAGATGGAGAAGAAACA

AAACCAGTCATTCTCCGTGCTTTCCCAGATAGGATTCCTGAATTCAATGAATTTTATATTCTAAGGCTTGTAAATATTTCAG GTCCTGGAGGTCAACTA

GCAGAAACCAACTTTCAGGTGACAGTCATGATTCCATTCAATGACGATCCGTTTGGAATTTTCATCTTAGATCCAGAGTGTCTAGAGAGAGAAGTAGCTG

AAGATGTCCTCTCAGAAGACGACATGTCTTACATCACCAGCTTCACCATTTTGAGACAACAGGGTGTCTTTGGTGATGTACGGGTTGGCTGGGAAGTCCT

GTCCAGAGAGTTTACTGCTGGCCTTCCACCAATGATAGACTTTATACTGCTAGGAAGTTTTCCAAGCACTGTGCCTTTGCAACCACATATGCGACGTCAC

CACAGTGGAACAGACGTCCTGTACTTCAGTGGACTAGAGGGTGCATTTGGGACTGTTGATCCCAAGTACCAACCCTTCAGAAATAACACAATTGCCAACT

TTACGTTTTCAGCTTGGGTAATGCCTAATGCCAACACAAATGGGTTTCTCATAGCAAAGGATGACAGTCATGGTAGCATCTACTATGGAGTAAAAATCCA

AACAAATGAAACCCACGTGACCCTTTCCCTTCATTATAAAACTTTTGGATCAAATGTTACATATATTGCCAAGAGCACTGTCATGAAATATTTAGAGGAA

GGTGTTTGGCTTCATGTTTTAATCATCTTAGATGATGGCATAATTGAATTCTATCTGGACGGAAAGGCAATGCCCAGAGGCATAAAGAGTCTGAAAGGAG

AAGCTATTACTGATG GTCCTGGGATCCTGAGAATTGGAGCAGGGATGGATGGTGGTGCCAGATTCACAGGTTGGATGCAGGATGTGAGGACCTATGAGC

GCAAGCTGACTCCCGAGGAGATTTACGAACTTCATGCTGTGCCTGCAAGGACTGATTTACACCCGATTTCTGGGTATCTGGAGTTCAGACAAGGAGAAAG

TAACAAGTCGTTCATTGTTGCTGCAAGAGATGACAGTGAAGAGGAAGGAGAAGAATTATTCCTTCTTAAGCTGGTCTCTGTGGATGGTGGGGCTCAGATT

TCTAAGGAAAACACTACTGCTCGGCTAAGAATACAGAAAAGTGACAATGCCAATGGCCTGTTTGGCTTCACTGGGGCTTGTATACCAGAG ATGACAGAG

GAGGGGTCCACTGTTTCCTGTGTGGTTGAGCGAACGAGGGGAGCTCTGGGTTACGTGCATGTTTTCTACACCATCTCCCAGATCGAGTCAGAAGGCATCA

ATTACCTCGTTGATGATTTTGCCAATGCCAGTGGCACTATCACCTTCTTGCCTTGGCAGCGGTCTGAG GTCCTGAATCTGTACGTTCTTGATGAGGACA

TGCCTGAGCTAAATGAATATTTTCGGGTGACGTTGGTGTCTGCAGTTCCAGGAGATGGAAAACTTGGTTCAACTCCCATCAGTGGTGCCAGCATAGATCC

TGAGAAGGAAACCACAGGCATCACTGTCAAAGCTAGTGACCATCCTTACG GCTTGATGCAGTTCTCCACAGGGTTGCCTCCTCAGCCTGAAGATTCAAT

GAGTCTGCCTGCTAGCAGTGTGCCACATATCACAGTGCAGGAAGAGGATGGCGAAATCCGTTTACTGGTCATTCGTGCACAAGGGCTCCTTGGTCGGGTG

ACTGTAGGATTTAGAACAGTATCCCTGACAGCATTTAGTCCAGAGGACTACCAG AGCACTGCTGGCACATTAGAATTTCAATCAGGAGAAAGATATAAA

TATATATTTGTCAACATCACTGATAATTCCATCCCTGAACTGGAAAAATCTTTTAAAGTTGAGTTGTTAAACTTGGATGGAGGAG TGTCTGACCTCTTT

AGGGTTGATGGCAGTGGGAGTGGAGAAGCGGACACGGATTTCTTCCTTCCACCTGTCCTCCCGCATG CCAGTCTAGGAGTGGCTTCCCAGATTCTGGTG

ACCATTGCTGCCTCTGACCATGCTCATGGGGTGTTTGAATTCAGCCCTGAATCACTCTTCGTCAGTGGAACTGAACCAGAGGATGGATACAGTACTGTCG

TGTTAAAT GTTACACGGACTCGGGGAGCCCTGTCTGCAGTGACTTTGCAATGGAAGGTAGACTCGGACCTGGATGGGGATCTCGCCATTACATCTGGCA

ACATCACATTTGAGACTGGGCAGAGGATTGCTTCCATCACTGTGGAGATACTGTCAGATGAAGAGCCAGAGCTAGACAAGGCACTCACCGTGTCGATCCT

CAACGTGTCCAGTGGCTCCTTGGGAGTTCTTACAAATGCCACATTGACAATTTTGGCTAGTGATGATCCTTATGGGGTCTTTATTTTTCCTAACAAAACT

AGACCTTTGAGTGTTGAAGAAGCAACCCAGAATGTCACATTATCGATAATAAGGTTGAAAGGCCTCATGGGAGAAGTTGCAGTCTCATATGCAACCATAG

ATGATATGGAAAAGCCACCGTATTTCCCACCTAATTTAGCTAGAGCAACTCAAGGAGGAGATTACATATCAGCATCTGGATTGGCTCTTTTCAGAGCTAA

TCAGACTGAGGCAACAATCACTATTTCAATCCTAGATGATGCTGAACCAGAACGCTCAGAATCTGTGTTCATTGAACTTTTCAATTCCTCTTTAGTAGAC

AAAGTACAGAATCGCCCAA TCCCACATTCTCCACGCCTTGGGCCTAAGGTGGAGACTGTGGCCCATCTCGTTATTGTTGCCAATGACGATGCATTTGGA

ACTGTGCAGCTGTCTGCAACATCTGTTCATGTAGCAGAAAATCATGTTGGACCCATTATCAATGTGACTCGAACTGGAGGAACATTTGCAGATGTTTCTG

TTAAGTTTAAAGCTGTGCCAATAACTGCAGCAGCGG GTGAGGACTATAGTATAGCATCTTCAGACGTGGTCTTGCTGGAAGGGGAAACCACTAAAGCTG

TGCCAATATATATCATTAACGACATCTACCCTGAGCTGGAAGAAACCTTTCTTGTGCAGCTACTAAACGAAACAACAGGTGGAGCCACACTGGGGCCTCT

GAGAGAGGCAGTCATTACCATAGAGGCGTCTGATGACCCCTACGGACTGTTTG GTTTTCAGAATACTAAATTTATTGTAGAGGAACCTGAGTTTAACTC

AGTGAGGGTAAACGTGCCAATAATTCGAAATTCTGGGACACTCGGCAATGTTACTGTTCAATGGGTTGCCATCATTAATGGACAGTTTGCTACTGGCGAC

CTGCGAGTTGTCTCAGGTAATGTGACCTTTGCCCCTGGGGAAACCATTCAAACCTTGTTGTTAGAGGTCCTGGCTGACGACGTTCCGGAGATTGAAGAG 

GTTGTCCAGGTGCAACTAGCTGCTGCCTCTGGCGGAGGTACAATTGGGTTAGATCGAGTGGCAAATATTGTTATTCCTGCCAATGATAACCCTTACGGTT

CAGTAGCCTTTGTTCAGTCCGTTTTTCGTGTCCAAGAGCCTCTAGAGAGAAGTTCCTATGCTAACATAACTGTCAGGAGAAG CGGAGGACACTTTGGTC

GCCTGCTGTTGTGCTATGGTACTTCTGATATTGATGTAGTGGCTCGTGCAGTTGAGGAAGGTGAAGATGTGTTATCCTACTATGAATCACCGACTCAAGG

GGTGCCCGACCCACTCTGGAGAACTTGGGTGAACGTGTCTGCAGTGGAGGAGACACAGTATACCTGTGCCACTTTGTGTCTCAAAGAACGTGCCTGCTCA

GCGTTTTCAGTTGTCAGTGGTGCCGAGGGCCCTCGGTGCTTCTGGATGACGTCGTGGGTCAGCGGAACTGTGAACAGCTCTGACTTCCAAACCTACAAGA

AGAACATGACTAGGGTGGCCTCTCTTTTCAGTGGCCAGGCAGTTGCTGGTAGTGACTACGAGCCTGTGACAAGACAGTGGGCCGTGATACTGGAAGGTGA

TGAGTTTGCAAATCTCACTGTTTCTGTACTTCCTGACGATGCTCCCGAGATGGATGAAAGTTTCCTAATTTCTCTCCTTGAAGTTCACCTTATGAACATC

TCAGACAGTTTTAAAAACCAGCCAACCATAGGACATCCGAATACTTCCGCTGTGGTCATAGGACTGAATGGCGATGCCTTTGGAGTATTCATTATCTACA

GTGTTAGTCCCAATACCTCGGAAGATGGCTTATGTGTGGAAGTGCAGGAACAGCCACAAACTTCTGTGGAACTGGTTATCTACAGGACAGGAGGCAGCCT

GGGGCAGGTCATGGTCGAATGGCGCGTTGTTGGTGGAACGGCTACTGAAGGTTTAGATTTTATGGGTGCTGGAGACATTCTTACTTTTGCAGAAG GTGA

AACCAAAAAGATGGCCATTTTAACCATTTTGGATGATTCTGAGCCAGAGGACAATGAAAGCATCCTTGTCCGTCTGGTGGCCACAGAGGGCGGAAGCAGA

ATCCTGCCCAGCTCAGACACCGTGACAGTCAACATCTTGGCAAACGACAATGTGGCAGGAATTGTCAGCTTTCAGACAGCTTCCAGATCTGTCATAGGCC

ACGAAG GAGAAATGTTGCAGTTCCATGTGGTAAGAACACCCCCAGGTCGAGGAAATGTCACTGTCAACTGGAAAGTTGTTGGACAAAATCTAGAAGTCA

ATTTTGCTAACTTTACGGGCCAACTCTTCTTCTCTGAG GGTACATTGAATAAAACAATATTTGTACATTTGTTGGATGACAATATTCCTGAGGAGAAAG

AAGTATACCAGGTTGTTCTGTATGATGTCAAGACCCAAG GAGTGTCGCCAGCAGGAGTTGCTCTACTTGATGCCCAGGGATATGCAGCTGTACTGACAG

TGGAAGCAAGCGATGAGCCACACGGTGTTTTAAACTTTGCTCTCTCCTCAAGATTTGTTGTGCTCCAGGAGGCTAATGTAACAATTCAGCTCTTCGTCAA

CAGAGAGTTCGGATCTCTAG GAGCCATCAATGTCACGTATGCTACTGTTCCTGGAATAGTAAGTCTGAAAAACAACACAGAAGGCAACCTAGCAGAGCC

AGAGTCTGACTTCATCCCTGTGGTGGGCTCTCTGGTTTTGGAGGAAGGGGAAACAACAGCAGCTATCAGTATCACTGTCCTCGAG GATGATATACCAGA

GCTAAAAGAATATTTCTTGGTGAATTTAACTCATGTTGATCTCATTATGGCTCCTCTGACTTCATCTCCTCCCAGACTAGGTATGGGGCTCTCCTTTATG

AACCTTTTGACTAACTGTGAGAGTCAGAGGACTTCATTGTTTTAATCAGAGTGACTTGTTATGGGAACGTAACACCGCCCCTTGTTTTGTTTGCTAATTT

CAGCCATGTGTGAGGATGTGATGAGCATTTAGACTTGTTCTAGTTAGAGACTGTCATTGTAAGCAGTGTAAGGCAATAATTACTCTGGTGCTTTTTAAAT

TTTACAACTATGTTACTGCCAGATATGCAACCTGCAAGGTGGTATTACTTTTTTCAAATGTATTTTTCCTTCATTTTCTTTTAAAATGTAACTAGCTATC

TTCATAAGTCAACAGTTTTCTTTTAAGTTTAATATTTATTTTGTGA
Translation
MCLPSLRPSHCSFCVDRVETERFVVYFG GVSVDSDVLKSGYTSRDLIILENDDPGGIFEFSYDSRGPYVIK EGDAVELRITRSRGSLVKQFLRFHVEP

RESNEFYGNMGVLEFTPGEREVVITLLTRLDGTPE LDEHFWVILSSHGERESKLGCATLVNITILKNDYPHGIIEFVSDGLSASIKESKGEDIYHA AV

YGVIRTRGNFGAVNVSWMVSPDFTQDVFPVQGTVCFGDQEFFKNITVYSLVDE IPEEMEEFTIILLNATGGAQTGIRTTASLRILRNDDPVYFAE EPC

VLRVQEGETANFTVLRNGSVDGACTVQYATVDGKASGEEGDFAPVEKGETLVFEVGSREQSISVHVKDDGIPETDEPFYIVLFNSTG GDTVVYEYGVAT

VIIEANDDPNGVFSLEPIDKAVEEGKTNAFW WILRHRGHFGNVSVAWQLFQNASLQPGQEFYETSGTVNFTDGEETKPVILRAFPDRIPEFNEFYILRL

VNISG GPGGQLAETNFQVTVMIPFNDDPFGIFILDPECLEREVAEDVLSEDDMSYITSFTILRQQGVFGDVRVGWEVLSREFTAGLPPMIDFILLGSFP

STVPLQPHMRRHHSGTDVLYFSGLEGAFGTVDPKYQPFRNNTIANFTFSAWVMPNANTNGFLIAKDDSHGSIYYGVKIQTNETHVTLSLHYKTFGSNVTY

IAKSTVMKYLEEGVWLHVLIILDDGIIEFYLDGKAMPRGIKSLKGEAITDG GPGILRIGAGMDGGARFTGWMQDVRTYERKLTPEEIYELHAVPARTDL

HPISGYLEFRQGESNKSFIVAARDDSEEEGEELFLLKLVSVDGGAQISKENTTARLRIQKSDNANGLFGFTGACIPE MTEEGSTVSCVVERTRGALGYV

HVFYTISQIESEGINYLVDDFANASGTITFLPWQRSE VLNLYVLDEDMPELNEYFRVTLVSAVPGDGKLGSTPISGASIDPEKETTGITVKASDHPYG 

GLMQFSTGLPPQPEDSMSLPASSVPHITVQEEDGEIRLLVIRAQGLLGRVTVGFRTVSLTAFSPEDYQ STAGTLEFQSGERYKYIFVNITDNSIPELEK

SFKVELLNLDGGV VSDLFRVDGSGSGEADTDFFLPPVLPHA ASLGVASQILVTIAASDHAHGVFEFSPESLFVSGTEPEDGYSTVVLN VTRTRGALS

AVTLQWKVDSDLDGDLAITSGNITFETGQRIASITVEILSDEEPELDKALTVSILNVSSGSLGVLTNATLTILASDDPYGVFIFPNKTRPLSVEEATQNV

TLSIIRLKGLMGEVAVSYATIDDMEKPPYFPPNLARATQGGDYISASGLALFRANQTEATITISILDDAEPERSESVFIELFNSSLVDKVQNRPI IPHS

PRLGPKVETVAHLVIVANDDAFGTVQLSATSVHVAENHVGPIINVTRTGGTFADVSVKFKAVPITAAAG GEDYSIASSDVVLLEGETTKAVPIYIINDI

YPELEETFLVQLLNETTGGATLGPLREAVITIEASDDPYGLFG GFQNTKFIVEEPEFNSVRVNVPIIRNSGTLGNVTVQWVAIINGQFATGDLRVVSGN

VTFAPGETIQTLLLEVLADDVPEIEE VVQVQLAAASGGGTIGLDRVANIVIPANDNPYGSVAFVQSVFRVQEPLERSSYANITVRRS SGGHFGRLLLC

YGTSDIDVVARAVEEGEDVLSYYESPTQGVPDPLWRTWVNVSAVEETQYTCATLCLKERACSAFSVVSGAEGPRCFWMTSWVSGTVNSSDFQTYKKNMTR

VASLFSGQAVAGSDYEPVTRQWAVILEGDEFANLTVSVLPDDAPEMDESFLISLLEVHLMNISDSFKNQPTIGHPNTSAVVIGLNGDAFGVFIIYSVSPN

TSEDGLCVEVQEQPQTSVELVIYRTGGSLGQVMVEWRVVGGTATEGLDFMGAGDILTFAEG GETKKMAILTILDDSEPEDNESILVRLVATEGGSRILP

SSDTVTVNILANDNVAGIVSFQTASRSVIGHEG GEMLQFHVVRTPPGRGNVTVNWKVVGQNLEVNFANFTGQLFFSE GTLNKTIFVHLLDDNIPEEKE

VYQVVLYDVKTQG GVSPAGVALLDAQGYAAVLTVEASDEPHGVLNFALSSRFVVLQEANVTIQLFVNREFGSLG GAINVTYATVPGIVSLKNNTEGNL

AEPESDFIPVVGSLVLEEGETTAAISITVLE DDIPELKEYFLVNLTHVDLIMAPLTSSPPRLGMGLSFMNLLTNCESQRTSLF
Transcript ENSMUST00000095585
Sequence
GGGGAAAGGATTAGCGTTGCAGAGGGTTGCGCTGGGTGTGAAGGGAGGAACGGCAGCGGTGGGGACCCTGGGTGTGAAGGGAGGCCCGGCACCGGCGGGG

ATCGGAGGGCACGCAGATGTCGGTGACCTCAGAACCAG - UNI23109 - - UNI34617 - GGATGATCTCTTCATTTTTACTAGTATACCTGTCA

ACCTTGTTCATCTCTTTTGTATTTGGAGAAGCGGAAATAAGATTCACTGGACAGACAGAGTTCTTCGTTAATGAGACAAGTACCACAGTTATTCGTCTTG

TCATTGAGAGGATAGGCGAGCCCGCAAATGTTACTGCCATTGTGTCG CTGAGCGGAGAAGACACTGGTGACTTTTTTGATACATACGCCGCAGCGTTTA

TCCCTGCCAGAGGAACAAACAGGACAGTGTACATAGCAGTATGTGACGACGATCTTCCGGAGCCTGATGAAACCTTCACATTTCACTTGACATTACAG A

AACCCTCAGCAAATGTGAAACTTGGATGGCCAAGGGCTGCTTCTGTGACAATCCTATCAAATGACAATGCATTTGGAATCATTTCCTTTAGTACG CCCT

CATCAATCTCGGTGATTGAGCCAAGGAGCAGAAATGCATCTGTACCTCTTACTCTCATCAGAGAAAAAGGGACCTATGGAATGGTCACCGTGACTTTTGA

T GTATCAGGTGGCCCAAATCCCCCTGAGGAAGACTTGAATCCAGTTAGAGGAAATATCACCTTCCCACCTGGCAGAGCAACTGTGATTTACAACGTGAC

AGTTCTTGATGATGAG GTACCAGAAAATGATGAACTATTTTTGATTCAACTGAGAAGTGTAGAAGGAGGAGCAGAGATTAATGCTTCTAGGAGCTCGGT

TGAAATCATTGTGAAGAAAAATGATAGTCCTGTGAACTTCATGCAGAGTGTTTACGTGGTTCCCGAGGACGACCACGTACTCACTATTCCCGTGCTTCGT

GGGAAGGATAGTGATGGAAATCTCATTGGATCTGATGAAACCCAAGTGTCAATCAGATACAAAGTAATGACTTGGGATTCAACAGCACATGCCCAGCAAA

ACGTTGACTTTATTGATCTTCAGCCGGATACTACTCTTGTCTTTCCCCCTTTTGTTCATGAATCACACCTGAAATTTCAGATAATCGATGACCTTATACC

CGAGATAGCTGAGTCATTTCACATCATGTTACTAAAGAACACCTTACAGGGAGATGCTGTGCTAATGGGCCCTTCTACAGTACAGGTCACCATTAAGCCA

AATGACAAGCCCTATGGAGTTCTTTCATTCAATAGTATTTTGTTTGAAAGACCAGTTATAATTGATGAAGATACAGCATCCAG TTCTAGATTTGAAGAA

ATTGCAGTGGTTAGAAATGGTGGCACACATGGGAATGTCTCTGTGAGCTGGGTGTTGACACGGAACAGCAGTGATCCCTCACCAGTGACCGCAGACATCA

CCCCTGCTTCTGGGACTCTGCAGTTCGCACAAGGGCAGATGCTGGCGCCAATTTCTCTAGTGGTCTTTGACGATGATCTTCCAGAAGAGGCTGAAGCTTA

CTTACTTACAATCTTGCCTCACACCATACAAGGAGGCGCTGAAGTGAGCGAGCCAGCGCAG CTTCTGTTCTACATTCAGGACAGCGATAATGTTTATGG

AGAAATAGCCTTTTTTCCTGGGGAAAGCCAGAAGATTGAAAGCAGCCCTAGTGAGCGATCCTTATCCCTGAGTTTGGCGAGACGTGGGGGAAGTAAAGGA

GACGTGAGGGTGATTTATTCTGCACTTTATATTCCTGCTGGAGCTATGGACCCCTTGCGAGCAAAAGATGGCATCTTAAATACATCTAGGAGAAGCAGCC

TCCTTTTCCCAGAACAGAACCAACAAGTTTCTATAAAATTACCGATAAGGAATGATGCATTCCTCCAGAATGGGGCCCACTTCCTAGTGCAG TTGGAAG

CTGTGGTGTTGGTGAACATATTCCCTCCGATTCCACCAGTAAGTCCCAGATTCGGAGAAATCAGAAATATTTCATTACTGGTTACCCCAGCCATTGCAAA

TGGAGAAATTGGCTTTCTTAGCAACCTTCCAATTATTTTGCATGAACCCAAAGATTCTTCTGCTGAGGTG GTATCTATCCCCTTGCATCGAGATGGAAC

TGATGGCCAGGCTACCGTGTACTGGAGTTTGCGGCCCTCTGGCTTTAATTCAAAAGCAGTGACTTTGGATGACGCAGGTCCTTTTAATGGCTCTGTTGTG

TTTTTATCTGGACAAAACGAAACATCAATCAACATTACTGTCAAAGGCGATGACATACCGGAGTTGAATGAAACTGTAACCCTTTCTCTAGATAG GGTG

AGCGTGGACAGTGACGTCCTAAAATCAGGCTATACTAGCCGAGACTTGATTATTTTGGAAAATGATGACCCTGGAGGCATTTTTGAATTTTCTTATGATT

CTAGAGGACCCTATGTTATAAAA GAAGGAGATGCCGTGGAGCTCCGGATTACTCGGTCCAGGGGGTCGCTTGTTAAACAGTTCCTCCGCTTTCACGTGG

AACCCAGAGAGAGCAATGAATTCTATGGAAACATGGGGGTGCTAGAATTCACCCCAGGAGAACGGGAAGTAGTGATCACCCTCCTCACCAGACTGGATGG

CACACCAGAG TTGGACGAGCACTTCTGGGTGATCCTCAGCAGCCATGGTGAGAGAGAGAGCAAGCTGGGCTGTGCTACACTCGTCAACATAACGATTCT

CAAAAACGACTATCCTCATGGGATTATAGAATTTGTTTCCGATGGTTTGAGTGCATCGATAAAAGAGAGCAAAGGGGAGGATATCTATCATG CTGTTTA

TGGTGTAATACGAACTCGAGGCAACTTTGGTGCTGTTAATGTATCATGGATGGTTAGTCCAGACTTTACGCAAGATGTATTTCCTGTGCAAGGAACTGTT

TGTTTTGGAGACCAAGAATTTTTTAAAAACATCACTGTCTACTCCCTTGTAGATGAA ATTCCAGAGGAGATGGAAGAATTCACCATTATCCTACTTAAT

GCCACTGGAGGAGCTCAAACAGGGATCAGGACAACTGCCTCCCTGAGGATTCTCAGGAACGATGACCCCGTTTACTTTGCAG AGCCTTGTGTTTTGAGG

GTCCAGGAGGGTGAGACTGCCAACTTTACAGTTCTCAGAAATGGATCTGTTGACGGGGCCTGCACTGTCCAGTATGCTACCGTGGATGGGAAGGCTTCAG

GAGAAGAGGGAGACTTCGCTCCTGTGGAGAAGGGAGAAACTCTTGTGTTTGAAGTTGGAAGCAGAGAGCAGAGTATATCTGTACATGTCAAGGATGACGG

AATCCCAGAAACAGATGAGCCTTTTTATATAGTCCTGTTCAACTCAACAG GTGACACAGTGGTTTATGAGTACGGGGTAGCTACAGTCATAATTGAAGC

CAACGATGACCCAAATGGTGTTTTCTCTCTGGAGCCCATAGACAAAGCAGTGGAAGAAGGAAAGACAAATGCATTTTG GATTTTACGGCACCGAGGACA

CTTCGGCAATGTTTCTGTGGCTTGGCAGCTGTTCCAGAATGCTTCTCTGCAGCCTGGACAAGAGTTCTATGAAACATCAGGGACTGTTAACTTCACAGAT

GGAGAAGAAACAAAACCAGTCATTCTCCGTGCTTTCCCAGATAGGATTCCTGAATTCAATGAATTTTATATTCTAAGGCTTGTAAATATTTCAG GTCCT

GGAGGTCAACTAGCAGAAACCAACTTTCAGGTGACAGTCATGATTCCATTCAATGACGATCCGTTTGGAATTTTCATCTTAGATCCAGAGTGTCTAGAGA

GAGAAGTAGCTGAAGATGTCCTCTCAGAAGACGACATGTCTTACATCACCAGCTTCACCATTTTGAGACAACAGGGTGTCTTTGGTGATGTACGGGTTGG

CTGGGAAGTCCTGTCCAGAGAGTTTACTGCTGGCCTTCCACCAATGATAGACTTTATACTGCTAGGAAGTTTTCCAAGCACTGTGCCTTTGCAACCACAT

ATGCGACGTCACCACAGTGGAACAGACGTCCTGTACTTCAGTGGACTAGAGGGTGCATTTGGGACTGTTGATCCCAAGTACCAACCCTTCAGAAATAACA

CAATTGCCAACTTTACGTTTTCAGCTTGGGTAATGCCTAATGCCAACACAAATGGGTTTCTCATAGCAAAGGATGACAGTCATGGTAGCATCTACTATGG

AGTAAAAATCCAAACAAATGAAACCCACGTGACCCTTTCCCTTCATTATAAAACTTTTGGATCAAATGTTACATATATTGCCAAGAGCACTGTCATGAAA

TATTTAGAGGAAGGTGTTTGGCTTCATGTTTTAATCATCTTAGATGATGGCATAATTGAATTCTATCTGGACGGAAAGGCAATGCCCAGAGGCATAAAGA

GTCTGAAAGGAGAAGCTATTACTGATG GTCCTGGGATCCTGAGAATTGGAGCAGGGATGGATGGTGGTGCCAGATTCACAGGTTGGATGCAGGATGTGA

GGACCTATGAGCGCAAGCTGACTCCCGAGGAGATTTACGAACTTCATGCTGTGCCTGCAAGGACTGATTTACACCCGATTTCTGGGTATCTGGAGTTCAG

ACAAGGAGAAAGTAACAAGTCGTTCATTGTTGCTGCAAGAGATGACAGTGAAGAGGAAGGAGAAGAATTATTCCTTCTTAAGCTGGTCTCTGTGGATGGT

GGGGCTCAGATTTCTAAGGAAAACACTACTGCTCGGCTAAGAATACAGAAAAGTGACAATGCCAATGGCCTGTTTGGCTTCACTGGGGCTTGTATACCAG

AG ATGACAGAGGAGGGGTCCACTGTTTCCTGTGTGGTTGAGCGAACGAGGGGAGCTCTGGGTTACGTGCATGTTTTCTACACCATCTCCCAGATCGAGT

CAGAAGGCATCAATTACCTCGTTGATGATTTTGCCAATGCCAGTGGCACTATCACCTTCTTGCCTTGGCAGCGGTCTGAG GTCCTGAATCTGTACGTTC

TTGATGAGGACATGCCTGAGCTAAATGAATATTTTCGGGTGACGTTGGTGTCTGCAGTTCCAGGAGATGGAAAACTTGGTTCAACTCCCATCAGTGGTGC

CAGCATAGATCCTGAGAAGGAAACCACAGGCATCACTGTCAAAGCTAGTGACCATCCTTACG GCTTGATGCAGTTCTCCACAGGGTTGCCTCCTCAGCC

TGAAGATTCAATGAGTCTGCCTGCTAGCAGTGTGCCACATATCACAGTGCAGGAAGAGGATGGCGAAATCCGTTTACTGGTCATTCGTGCACAAGGGCTC

CTTGGTCGGGTGACTGTAGGATTTAGAACAGTATCCCTGACAGCATTTAGTCCAGAGGACTACCAG AGCACTGCTGGCACATTAGAATTTCAATCAGGA

GAAAGATATAAATATATATTTGTCAACATCACTGATAATTCCATCCCTGAACTGGAAAAATCTTTTAAAGTTGAGTTGTTAAACTTGGATGGAGGAG TG

TCTGACCTCTTTAGGGTTGATGGCAGTGGGAGTGGAGAAGCGGACACGGATTTCTTCCTTCCACCTGTCCTCCCGCATG CCAGTCTAGGAGTGGCTTCC

CAGATTCTGGTGACCATTGCTGCCTCTGACCATGCTCATGGGGTGTTTGAATTCAGCCCTGAATCACTCTTCGTCAGTGGAACTGAACCAGAGGATGGAT

ACAGTACTGTCGTGTTAAAT GTTACACGGACTCGGGGAGCCCTGTCTGCAGTGACTTTGCAATGGAAGGTAGACTCGGACCTGGATGGGGATCTCGCCA

TTACATCTGGCAACATCACATTTGAGACTGGGCAGAGGATTGCTTCCATCACTGTGGAGATACTGTCAGATGAAGAGCCAGAGCTAGACAAGGCACTCAC

CGTGTCGATCCTCAACGTGTCCAGTGGCTCCTTGGGAGTTCTTACAAATGCCACATTGACAATTTTGGCTAGTGATGATCCTTATGGGGTCTTTATTTTT

CCTAACAAAACTAGACCTTTGAGTGTTGAAGAAGCAACCCAGAATGTCACATTATCGATAATAAGGTTGAAAGGCCTCATGGGAGAAGTTGCAGTCTCAT

ATGCAACCATAGATGATATGGAAAAGCCACCGTATTTCCCACCTAATTTAGCTAGAGCAACTCAAGGAGGAGATTACATATCAGCATCTGGATTGGCTCT

TTTCAGAGCTAATCAGACTGAGGCAACAATCACTATTTCAATCCTAGATGATGCTGAACCAGAACGCTCAGAATCTGTGTTCATTGAACTTTTCAATTCC

TCTTTAGTAGACAAAGTACAGAATCGCCCAA TCCCACATTCTCCACGCCTTGGGCCTAAGGTGGAGACTGTGGCCCATCTCGTTATTGTTGCCAATGAC

GATGCATTTGGAACTGTGCAGCTGTCTGCAACATCTGTTCATGTAGCAGAAAATCATGTTGGACCCATTATCAATGTGACTCGAACTGGAGGAACATTTG

CAGATGTTTCTGTTAAGTTTAAAGCTGTGCCAATAACTGCAGCAGCGG GTGAGGACTATAGTATAGCATCTTCAGACGTGGTCTTGCTGGAAGGGGAAA

CCACTAAAGCTGTGCCAATATATATCATTAACGACATCTACCCTGAGCTGGAAGAAACCTTTCTTGTGCAGCTACTAAACGAAACAACAGGTGGAGCCAC

ACTGGGGCCTCTGAGAGAGGCAGTCATTACCATAGAGGCGTCTGATGACCCCTACGGACTGTTTG GTTTTCAGAATACTAAATTTATTGTAGAGGAACC

TGAGTTTAACTCAGTGAGGGTAAACGTGCCAATAATTCGAAATTCTGGGACACTCGGCAATGTTACTGTTCAATGGGTTGCCATCATTAATGGACAGTTT

GCTACTGGCGACCTGCGAGTTGTCTCAGGTAATGTGACCTTTGCCCCTGGGGAAACCATTCAAACCTTGTTGTTAGAGGTCCTGGCTGACGACGTTCCGG

AGATTGAAGAG GTTGTCCAGGTGCAACTAGCTGCTGCCTCTGGCGGAGGTACAATTGGGTTAGATCGAGTGGCAAATATTGTTATTCCTGCCAATGATA

ACCCTTACGGTTCAGTAGCCTTTGTTCAGTCCGTTTTTCGTGTCCAAGAGCCTCTAGAGAGAAGTTCCTATGCTAACATAACTGTCAGGAGAAG CGGAG

GACACTTTGGTCGCCTGCTGTTGTGCTATGGTACTTCTGATATTGATGTAGTGGCTCGTGCAGTTGAGGAAGGTGAAGATGTGTTATCCTACTATGAATC

ACCGACTCAAGGGGTGCCCGACCCACTCTGGAGAACTTGGGTGAACGTGTCTGCAGTGGAGGAGACACAGTATACCTGTGCCACTTTGTGTCTCAAAGAA

CGTGCCTGCTCAGCGTTTTCAGTTGTCAGTGGTGCCGAGGGCCCTCGGTGCTTCTGGATGACGTCGTGGGTCAGCGGAACTGTGAACAGCTCTGACTTCC

AAACCTACAAGAAGAACATGACTAGGGTGGCCTCTCTTTTCAGTGGCCAGGCAGTTGCTGGTAGTGACTACGAGCCTGTGACAAGACAGTGGGCCGTGAT

ACTGGAAGGTGATGAGTTTGCAAATCTCACTGTTTCTGTACTTCCTGACGATGCTCCCGAGATGGATGAAAGTTTCCTAATTTCTCTCCTTGAAGTTCAC

CTTATGAACATCTCAGACAGTTTTAAAAACCAGCCAACCATAGGACATCCGAATACTTCCGCTGTGGTCATAGGACTGAATGGCGATGCCTTTGGAGTAT

TCATTATCTACAGTGTTAGTCCCAATACCTCGGAAGATGGCTTATGTGTGGAAGTGCAGGAACAGCCACAAACTTCTGTGGAACTGGTTATCTACAGGAC

AGGAGGCAGCCTGGGGCAGGTCATGGTCGAATGGCGCGTTGTTGGTGGAACGGCTACTGAAGGTTTAGATTTTATGGGTGCTGGAGACATTCTTACTTTT

GCAGAAG GTGAAACCAAAAAGATGGCCATTTTAACCATTTTGGATGATTCTGAGCCAGAGGACAATGAAAGCATCCTTGTCCGTCTGGTGGCCACAGAG

GGCGGAAGCAGAATCCTGCCCAGCTCAGACACCGTGACAGTCAACATCTTGGCAAACGACAATGTGGCAGGAATTGTCAGCTTTCAGACAGCTTCCAGAT

CTGTCATAGGCCACGAAG GAGAAATGTTGCAGTTCCATGTGGTAAGAACACCCCCAGGTCGAGGAAATGTCACTGTCAACTGGAAAGTTGTTGGACAAA

ATCTAGAAGTCAATTTTGCTAACTTTACGGGCCAACTCTTCTTCTCTGAG GGTACATTGAATAAAACAATATTTGTACATTTGTTGGATGACAATATTC

CTGAGGAGAAAGAAGTATACCAGGTTGTTCTGTATGATGTCAAGACCCAAG GAGTGTCGCCAGCAGGAGTTGCTCTACTTGATGCCCAGGGATATGCAG

CTGTACTGACAGTGGAAGCAAGCGATGAGCCACACGGTGTTTTAAACTTTGCTCTCTCCTCAAGATTTGTTGTGCTCCAGGAGGCTAATGTAACAATTCA

GCTCTTCGTCAACAGAGAGTTCGGATCTCTAG GAGCCATCAATGTCACGTATGCTACTGTTCCTGGAATAGTAAGTCTGAAAAACAACACAGAAGGCAA

CCTAGCAGAGCCAGAGTCTGACTTCATCCCTGTGGTGGGCTCTCTGGTTTTGGAGGAAGGGGAAACAACAGCAGCTATCAGTATCACTGTCCTCGAG GA

TGATATACCAGAGCTAAAAGAATATTTCTTGGTGAATTTAACTCATGTTGATCTCATTATGGCTCCTCTGACTTCATCTCCTCCCAGACTAG ATTCAGA

AGGCCTGACGGCACAGATTGTCATAGATGCCAATGACGGTGCCCAAGGCATGATTGAATGGCAGCGTAACAG ATTTGAAGTGAATGAAACCGACGGCGT

TGTAACACTGGTAGCGCAGAGGAGCAGAGCAGCCCTTGGCCAGGTGTCATTGTTTATGTATGCCCAGAACCTAGAGGCTCAGGCGGGGCTGGATTACATG

TGCACTCCACAG ATTCTTCACTTCACTGATGGAGAAAGGTTTAAGCATGTGGACGTCATGATTCTGGACGATGACATGCCAGAAGGAGACGAAAGATTT

CAGTTGCTATTAACAAATCCTTCTCCTGGACTAGAGCTGGGGAAAAATACCATAG CTTTGATTACTGTCCTTGCCAATGACGATGGCCCTGGAGTTCTG

TCCTTTAACAACAGCGGGCACATCTTCCTCAGGGAACCGACATCTCTCTACGTGCAGGAGAGTGTAGCAGTGTTAGTCATTGTTCGGGAACCAGCTCAAG

GTCTGTTTGGAACAGTGGCAGTTCAGTTTGTTGTGACAGAAGTCAACTCTTCAACTGAATCGAAGGACCTGTCTCCTTCCAAAGGCTTTATTGTTCTAGA

GGAAGGCGTTCGGTCCAAG ACCCTGCGCATCTCTGCCATATTAGACACGGAACCAGAAATGGACGAGCATTTTGTCTGCACCCTGTTTAATCCAACTGG

AGGTGCTAGACTAGGGGCCCATGTTCAAACCTTGATAACAATTTTTCAAAACCAGGCTCCTTTGGGACTATTCAGTATCTCTGCTGTTGAAAATAG TGC

CACCTCTATAGATGTTGAAGAATCCAACAGGAGTGTGTACCTCAATGTGTCACGTACAAATGGCCTTGACTTGACTGCGAGTGTGCAGTGGGAGACAGTA

TCTGAGACAGCCTTTGGCATGA GGGGAATGGATGTCGTCTTTTCCATATTTCAAAGCTTTTTTGACAAGACAGCACTGGACTGGTGTTTCTTTACTGTT

GAAGGCTCAGTTTACGGCGTAATGTTAAGAAAATCCTCATTAGTTGTTTATCGATGGCAAGGGACTTTTGTTCCTGTTGAG GACTTAAAGGTAGAAAGT

CCTAAAACTTGTGAGGCCTTTAATATTGGCGTTTCCCCATATCTTGTGATTACTCATGGGGAAAGAAGTGGAGAGAAGCCTTCCATTAACAGTGTGTACA

TGCTCACTGCTGGATTCAGATTAGTCCTG ATACAGACAATCATTATTTCAGGAAGCTGTCAAGTACGGCATTTCACCTCAGACAGTCAAGACTATTTCA

TCATTGCAAGTCGAAGAAATGATTCCGAATTAACCCAG GTCTTCAGATGGAACGGAAACAACTTTGCCTGGCATCAGACACTGCCTGTCCGAGGTGTGC

TGGGCATGGCCTTGTTCAGCAGAGGAGGCTCTGTCTTCTTAGCCATTTCTCAGGCTAACATCAGACAAACCTCCCTTTTGTTTACGTGGTCTGGTACTCA

GTTTATTAACTTTCAAGAACTGCCCATCAGTGGGATAACACAAGTTGAGGCTTTGTCCTCAGGCGATGATGTTTATTTATGTTTTGCCAAAAATACCTTT

CTAG GAAATCAGAATGCAATTGACATTTTTGTCTGGGAGATGGGGCATTCATCGTTGAGGTATTTCCAATCCCTGGACTTTGCTGCTGTTAAGAGAATC

CGTTCCTTCACACCAGCTTCTGGCATAG TCCACATACTTCTAACTGCCCAAGACGGGTCTGCTCTTTACTGCTGGAACTCAGAGCTGAATGCCTTCTCT

TTCGTCCTGGAAGCACCTGCTGCGCACGATGCAGCTTTTGTGACAGTGAAGTCGCTTAATTCAAGCAAGACTTTAATTGCTTTAGTGGGAGCCACTGACT

CCCATTTATATGAGTTGACCTACGTCTCCAGCCAGTCTGACTTTATTCCTAG TTTAGGTGAACTGATATTTGAACCTGGCGACAAGGAAGCAATCATAG

CAGTAAATGTCCTTGATGACACAGTTCCCGAAAAAGAAGAATCATTCAGAGTTCAGCTTAAAAGTCCAAGAGGCGGAGCAGAGATTGGCATTAACAGTTC

TGTGAGAGTCACTGTTCTCGCCAATGATGGTGCCTATGGAGTTGTAGCATTTGCCCAG AACTCACTGCATAAGCAATTGGAGGAATTGGAACGAGATAG

CCTGGTAACACTGAATGTTGAACGCTTGAGAGGAACACACGGCCGCATAACTGTAGCATGGGAAGCAGCCGGAAGTGTCAGTGATGTATTTCCCACCTCA

GGAGTG ATCTCATTCACAGAGGACCAGGCAATGTCTATGATCACTCTGACTGTTCTTGCGGATGATCTGCCGGAGTTATCCGAGGCTGTGGTTGTAACA

CTTACCCAGATTGTCACAGAGGGGGTTGAGGACCCATTGAAAGGTGCTACAATTGACCAGAGCAGAAGCAGGTCTGTGCTGACCATCCTGCCCAGTGACT

CGCCCTACGGTGTGGTTCGCTGGCACACCGAGTCTCTCTTCAATAGAGTGCCAGAGCCCACAG AGAACATCACTGTCGTTCAGTTACATATTGTTCGAG

ACAAAGGACTATTTGGGGACATTTCCATTCACTTGATAGCAAAACCCAATTTCTTATTACATATCAATAATCAAGCTACTGAGGATGAAGATTTTGTATT

GCAAGACTCAGTAATAATAATGAAAGAAAACATAAAAGAAACTCATGCTGAAGTCGCCATTTTGCCA GATGAGGTTCCTGAGCTGGATGAAGGACTCAT

TGTCACCATCGCTGCAGTGAACCTGGTTAACCCCAACTTTCCTGCAGAGCAGCCCCGTGTGCAGAGACCAAGGATGGAGTCAGCGGAGATACTGATTGAA

GAAAACGATGATCCCAGAGGGATTTTTAACTTTCATGTTGTCAGA GATGTTGGTGGAGTCATTATTGCTCATGAGGGGCCCCCGCCCTTGAATGTTCTT

CAAGTTCCTGTTGTCCGGATGGCTGGAACCTTTGAGACAGTGAATGTTTATTGGAAAGCAACACCAGACAGTGCTGGCCTGGAAGACTTTCAGCCATCTC

ACGGGATGCTCCAGTTTGCTGATGGACAA GTCATCGCACCAATACTTGTAACTATAATTGATGATTCTGAGTTTGAGCTCTTGGAAACGTTCACCATCT

CCCTAGTGAGTGTGACTGGTGGCGGCCGACTAGGTGATGATGTTTCGGTGAATGTTGTCATAGCACCGAATGACTCGCCCTTTGGAATATTTGGATTCGA

AAAGAAAACT GTAATGGTTGATGGACCGCTTTTGTCTGATGACCCTGATTCATATGTGACACTGACAGTCGTCCGGTCCCCAGGAGGAAAAGGAGCTGT

CCGACTTCACTGGGCTATTGAAGAGAAGGCCAAAGATGACCTCAGTCCTTTGAATGGAACACTATATTTTGATGAG ACTGAATCCCAGAAGTCTGTTAT

ATTGCACACACTTAAGGACGGCATGGTGGGGGAAGACAGGCGCTTCATTATTGAGCTGACAGCTGCTGATGAGGTAGAAATATCTCCAGTGAAAG GTAG

CGCATCAGTCATCATCCGAGGAGATAAGAGCATATCAGAAGTTGGAATTGCTTCATCATCCAGACACATCATTATTGGGGAACCCTCAGCCACATACAAT

GGCACTGCCATCATCGA CCTTGTTCGTGGCCCAGGGGTTTCAGGGGAGATCACAGTGAACTGGAAGATATTGCCTCCTTCCAGGGGGGAGTTTGTGGAG

ACATCAGGACAACTGACGATGCTGGATGGACAGACTGCTGCCACAGTAGTTATTCAG GCTTTGAATGATGACATCCCAGAGGAGAAGTGTCACTATGAG

TTTCAGCTCACTGAAATCAGTGAGGGTAGGATGCTGCATGAAGCCAGTGTCAGCGCCCGCATCACCATGGTGGCCAGTGACGCTCCCTATGGCCGGTTCT

CATTTTCACATGAGCAGCTTCACGTTTCCGAAGCAGCACAGAGG GTTAATGTCACAGTGGTCCGCTCAGGCGGCTCCTTTGGACGTGCACGAGTCTTGT

ATGAGACAGGTAGCAGGACGGCTGAGGCAGGCTGGGACTTTGTTCCTGCTTCTGGGGAGCTGCTCTTTGAAGCCAGAGAGAAGATGAAAAGTCTGTACAT

TGACATCCTTGATGACAACCTTCCTGAAGGCCCTGAGGAATTCGTTCTTGCCATTACAAGAGTGGACCTCCAGGGAAG AGGATATGATTTTACCATCCA

AGAGAATGGACTTCAGATAGATCAACCTCCTGAAATTGGGAACATCTCCATTGTTCGAATCATAATAATGAAAAATGATAATGCAGAAGGCATCATTGAA

TTTGATCCAAAGTATACTGACATCTCAG TGGAGGAAGATGCCGGCGTGATCACACTCCCTGTCCTGAGGCTTCATGGAACGTATGGCCACGTGTCAGCT

GATTTCAGCTCCCGGGGTTTCTCTGCAGTTCCAGGAGGCTACGTACTGCATGGCAGCTCGGTCACCTTTCAGCATGGACAGAACCTAAGCTTTATAAATG

TCTCCATCATCGATGACAATGGAAG TGAATTTGAGAAGCAGTTTGAAATTCTGCTCATTGGAGCTACGGGAGGAGCGATCCTTGGGCGCCACCTAGTGA

GCAAAATCACCATTGCCAAAAGTGACTCTCCCTTTGGCATCATACGATTTCTCAACCAAAGCAAAATTTCTCTTCCTAACCCCAGTTCCACAATGGCTTT

ACACTTGGTGCTGGAGCGGACCGGAGGACTCCTGGGAGAGATTCAG GTGAGCTGGGAGGTGGTAGGGCCCGATGCTGAGGAACCGTTACCGCCACACAA

TGGAGACTTTGCAGACCCAGTGAGTGGGACAGTCTCTTTTGGAGACGGAGAAGGTGGTGTGAGAAGCATCATCCTCAGAGTTTGTCCTCACGAAGAAACT

GAAGCTGAGGAGACTTTTATTGTTCAGCTCAAGCCTTTGAGAGAAGCGAAGTTAGATCCCAGAGCTAAAGCTGTTACGCTAACA ATACAGAAGTTTGGG

GATCCGAATGGAGTTATTCATTTTGCTCCCGAGTCTTTATCTAAGAGAAGGTTCTCAGAGCCACCTCCGTCGGATGGACCCCTGCTCGTGTCCTTCCTCG

TCACAAGGTCCAAAGGCACCTCTGGAGATATCAAG GTGCACTGGGAGCTAAGCAGCGAGTTTGACATCACTAGAGACTTTCTTTCCACACGAGGATTTT

TCACCATCGCTGATGGAGAGAGTGACGCAAGCTTTGATGTCCACTTGCTGCCAGATGATGTCCCTGAGATAGAGGAGGAATACGCTGTCCAGCTTGTTTC

TGTAGAGGGAGGTGCAGAACTGGACCTGGGAAAATGCACCGCGAGGTTCTCTGTGTCTGCCAATGACGACCCGCATGGTGTGTTTGCCCTGTATTCAGAT

CGGCAGTCAGTCCTGATTGGACAGAACCTTGACAGATCCATCCAGATTAACATCACCCGGCTCGCTGGAGCGTTTGGTGCTGTGGCTGTCAGAGTTCAAA

TACTATCTGATAATAAAGAAGACCCAGTGGCTACTGAAAATGAAGAGAGACAGCTGGTGATCACCGATGGTGCCAGATATAAAGTAGGCTTGGTGCCCTT

GAAGAATCAG GTTTTCCTATCTCTGGGCTCTAATTTCACCCTGCAGTTGGTGTCAGTAAGGCTTCTGAGTGGACCTTTCTATGGAATACCAACAATTCT

CCAGGAAGCGAAGAATGCTATTCTCTCTGTTCCTGAGGAAGCTGCCAATTCCCAG GTTGGCTTTGAATCTGCTGCTTTCCAGCTCATGGACATCAAGGC

CGGCACAAGCCAAGTCATGGTCTCCAGGAAAGGGACATACGGCAGGCTCTCTGTGGCCTGGACCACAGGTTACGCCCCTGGCTCTGAAATTCCTGAGCCT

ATTGTCATTGGCAACATGACACCAACCCTGG GGAGCCTTTCTTTTGTGCATGGAGAAGAGAGGAAGGGAGTCCTGCTGTGGACATTTCCCAGCCCTGGC

CGGCCAGAGGCATTTGTCCTTCATCTGTCAGGCCTGAGGAGCAGTGCTGCTGGTGGAGCTCAGCTTAG ATCAGGTTTCACTACTGCTGAAATTGAACCC

ATGGGAGTCTTCCAATTTTCCCCTAGTTCAAGAAATATCACAGTGTCAGAGGATGCACAGACGATCCGAATATGTGTGCAAAGACTCTTTGGGTTTCACG

GTGACCTGATTAAAGTCTCCTACGAGACAACTGCAGGAAGTGCCAAGCCTCCAGAGGACTTCGAAGCTGTTCAGAAGGGGGAAGTTTTTTTCCAGAGATT

CCAACCTGAGATTGATTTTGAAATAACCATTATTAATGATCAGCTTCCTGAGATAGAAGAAACATTTTACATTAATCTTACTTCAGTAGAAACCAGGGGG

TTGGGGAAGGGGGGTGTGAATTGGAGACCTCGCCTAAATCCAGATCTCAGTGTCGCAGTGGTCACCATAGTGGACAATGATGACTTGACTGGGGTAGCTG

TTTCTGTCCCTGTGACAGCAGGGACTGTGGCAGTTGACAGCACTCTCCTTGCCATGGAAACTGGTTCTACCACACACCCTAACAAAAGCAAGATAACCAC

CATTCCATATACCACGGAGGTGTTTGCCCCTGTTACAGAGACAGTAACTGTGTCTGCCATCCCTGAGAAACTTGCTACTGCTCATAGTGTCATATCTGTG

AAGCCTGATGTGGTCCCAGGAACTGTTCTTGCTTCAGTCTATGGAACCCTGAGTATCGGACCCCCCATTGTTTATGTGTCAGAGGAAATGAAGAATGGGA

CTCTCAGTACTGCAGATATCCTTATCCAGAGGATGGGTGGGTTCGCAGGCAATGTCACCATAACAGTGAAGACTTTCGGCGGAAGATGTGCTCAGAAGGA

ACCCAGTGTGTGGCCCTTCCAGGATGTCTATGGAGTTGGCAACCTAACAACATGGGCATTCGAAGAAGAAGACTTTGAAGAACAATTGCTCACCCTCACA

TTCCTCTATGGGGAAAGAGAACGTAAAATCGCAGTTCAGATTTTGGACGATGATGAGCCCGAGGGGCAGGAATTCTTCTACGTGTTTCTCACAGACCCTC

AAGGGGGAGCAGAGATTGTGAGGGGGAAGGACAGCACTGGGTTTTCAGCCTTTGCTGTCATCATTATCTCAG GGAGTGACCTCCATAATGGCATCATAG

GCTTCAGTGAGGAGTCCCAGAGAGGCCTGGAACTGAGGGAAGGAGCTGATAAAAACAGCCAGCGCCTAGTAGTCACAAGGCAGCCAAACAG GGCCTTTG

AAGAAGTTCAGATCTTTTGGCGAGTCACACTTAACCAAACAGTCACCATTCTCCAGGAGAAGGGGCTAAACCTAACAGATGAACTCCGGTTTGTGGCAGG

GGTCACAACTTGCACAGGAGGTCAAACGCGATGCTTTATTCACCTTGAGCTCAACCCCAAGAAG GTGCATCAAGTTGAAATGCCTTTCTTTGTGGAGCT

GTATGACGTCACTGCAGGGGCAGCTATAAACAACAGTGCTAGATTTGCTCCAATTAAACTTTCCAAGAGCGGTGCCCCTCAGAGCCTTGTTTCCTTCTCT

GTGGGTTCTCGGCTGGCAGTGGCTCACAAGAAGTCTACTTTGATCAGTTTGCAGGTGGCCAGAGATTCTGGGACAGGAATCATGATGTCTGTTAACTTTA

TTACCCAG GAGCTGAGGAGCGCTGAAACAGTTGGTCGGGTCCTCATATCTCCAGCTGTTTCTGGGAAGGATTTTGTGAGGACAGAAGGCACATTGGTCT

TCGAGCCTGGCCAGAAAAGTGCAGTGTTGGATGTTGTCTTAACACCAGAAACAGGGTCTTTAAATAAATTTCCTAAACGCTTTCAGATTGTGCTTTTTGA

CCCAAAAGGTGGTGCCAGAATTGATAAAGTGTATGGGACTGCCAACATCACTCTCATCTCTGATGCGGATTCACAAGCTGTCTGGGGGCTTGAAGACCTG

CTACATCAGCCCCTACATGAAGATATTCTCAACAGAGTGCTCCATAACCTCAACCTGCGAGTAGCCACAGAGAGCACAGATGAGCAGCTCAGTGCTGTGA

TGCTCATCATGGAAAAG ATAACAATGGAAGGAAGAAATCAAGCTTTCAGTATCAAAAGCCGAACTCTTTTGTATGAGCTCCTTTGTGTTCTAATTAACC

CAAAGCGCAAAGACACTAGGGGATTCAGCCACTTTGTGGAGGTGGCTGAGCATTTTGCCTTTTCTCTGCTGACTGATGTTACCTGTGGGTCGCCTGGTGA

AAA AAGCAAAACCATCCTTGACAGTTGCCCATATCTGTCAATTCTGGCTCTTCACTGGAACCCTCAACAGATCAATGGACACAAGTTTGAAGGGAAGGA

AGGTGATTACATTCAAATTCCAGAGAGGCTACTGGATGTCCCTGAGGCAGAAATGCTGGATGGGAAAAATGCATGCACATTAGTTCAGTTTGTGGAGTAC

AGCAGCCAGCAGTGGTTCATAGCAGGAGACAACCTTCCTGCCCTAAAAGACAAG GTATTGTCTTTGAATGTGAAAGGTCAGAGTGCACAACCTCTGCCT

AACAACAATGAGGTTCTCTACAGGATTCATGCAGCTGAGCCTAGAGTTGTTCCTCATACATCTCGGTGTCTCCTCTGGAATCAGGCAGCTGCCAG CTGG

TTGTCTGACAGCCAGTTTTGCAAAGTGGTTGAAGATGCTTCGGACTATGTGGAATGTGCCTGTTCACACATGTCTGTGTATGCTGTCTACGCCCAGACTG

ACAACTCGTCGTCATACAATGAAGCTTTTTTCTCTGCTGGGTTGATATGCATCTCAG GTCTTTGCTTGGCTGTTGTTTCACACATGTTCTGTGCCCGAC

ACTCCATGTTTGCAGCTAAGCTTCTGACTCACATGATGGTGGCCAGCTTAGGAACCCAG ATTTTGTTCCTGGCATCTGCATATGCAAGTCCCCACCTCA

GCGAGGAGAGCTGCTCCGCTGTGGCTGCTGTGGCGCATTACCTGTATCTTTGCCAGTTTAGCTGGATGCTCATTCAG TCTGTGAACTTCTGGTACGTGC

TGGTGGTGAGTGATGAGCACACGGAGAGGCGGTGCCTGCTCTTCTGCCTTCTCAGCTGGGGGCTTCCATCTTTCGTGGTGATTCTCCTCATACTTATTTT

GAGAGGAATCTATCATCGGAGCATGCCGCAGATCTATGGACTTATTCATGGTGACCT ATGCTTCATCCCAAACATCTATGCTGCTCTGTTCACGGCTGC

TCTTGTTCCTCTAATGTGCCTCGTGGTGGTATTTGTGGTGTTCATTCATGCCTACCAGCTGAAGCCGCAGTGGAAAGGTTATGATGACGTCTTCAGAGGA

CGAACCAACGCAGCAG AAATTCCTCTGATTTTATATCTCTTCGCCCTGATTTCTATGACGTGGCTTTGGGGAGGACTGCATATGGCCTACAGACACTTC

TGGATGTTGGTTCTCTTTGTCATTTTCAATAGTCTGCAG GGACTTTATGTTTTTGTGGTTTATTTCATTTTACACAACCAAACGTGTTGCCCTATGAAG

GCCAGCTATACAGTAGAAATGAATGGTCACCCAGGACCCAGCACAGCCTTCTTCACTCCTGGGAGCGGAATACCTCCAGCTGGAGAGATAAACAAGTCTA

CCCAGAACCTCATCAATGCTATGGAAGAG GTGCCATCTGACTGGGAAAGATCATCCTTCCAGCAGACCAGCCAGGCAAGCCCTGATTTGAAGACAAGTC

CCCAGAATGGTGCCTCATTCCCTTCTTCTGGAGGTTATGGCCCGGGGTCCCTGATAGCCGATGAAGAGTCCCAGGAGTTTGATGACCTGATATTTGCATT

AAAAACTG GTGCTGGTCTCAGTGTCAGTGACAACGAATCTGGTCAAGGAAGCCAGGAAGGAGGCACCCTGACTGACTCCCAGATTGTAGAACTCAGAAG

GATACCAATTGCTGACACCCACCTCTGAGAGTCCCATTTACACTCTCCAGTAGAAAGAGGACAAGTTTCCTCATTGCCTTGGCTTTTGTACTAAACTCTG

TAGGCATTTACAGCCATGTAGTAGAGACCTGTACATCGTACTGAGTAACACAGAAGTGATTATTATGTTATGCATTGCTTAGTGTTTGTGCAATTTAAAA

AAGACTGCTATAATAAAAGATCCGATCATTCCTGTAATGTACAAGGATATACATTATCCAAAAATATTAGTTGTTTTTTGATCATCCGAACTTGGCTAAC

ATGGTTTAATGAAAATAATCATCAATAAAAGTATTGGAATCCA
Translation
MSVTSEPG - UNI23109 - - UNI34617 - GMISSFLLVYLSTLFISFVFGEAEIRFTGQTEFFVNETSTTVIRLVIERIGEPANVTAIVS LSG

EDTGDFFDTYAAAFIPARGTNRTVYIAVCDDDLPEPDETFTFHLTLQ KPSANVKLGWPRAASVTILSNDNAFGIISFST PSSISVIEPRSRNASVPLT

LIREKGTYGMVTVTFD VSGGPNPPEEDLNPVRGNITFPPGRATVIYNVTVLDDE VPENDELFLIQLRSVEGGAEINASRSSVEIIVKKNDSPVNFMQS

VYVVPEDDHVLTIPVLRGKDSDGNLIGSDETQVSIRYKVMTWDSTAHAQQNVDFIDLQPDTTLVFPPFVHESHLKFQIIDDLIPEIAESFHIMLLKNTLQ

GDAVLMGPSTVQVTIKPNDKPYGVLSFNSILFERPVIIDEDTASS SSRFEEIAVVRNGGTHGNVSVSWVLTRNSSDPSPVTADITPASGTLQFAQGQML

APISLVVFDDDLPEEAEAYLLTILPHTIQGGAEVSEPAQ LLFYIQDSDNVYGEIAFFPGESQKIESSPSERSLSLSLARRGGSKGDVRVIYSALYIPAG

AMDPLRAKDGILNTSRRSSLLFPEQNQQVSIKLPIRNDAFLQNGAHFLVQ LEAVVLVNIFPPIPPVSPRFGEIRNISLLVTPAIANGEIGFLSNLPIIL

HEPKDSSAEV VSIPLHRDGTDGQATVYWSLRPSGFNSKAVTLDDAGPFNGSVVFLSGQNETSINITVKGDDIPELNETVTLSLDR RVSVDSDVLKSGY

TSRDLIILENDDPGGIFEFSYDSRGPYVIK EGDAVELRITRSRGSLVKQFLRFHVEPRESNEFYGNMGVLEFTPGEREVVITLLTRLDGTPE LDEHFW

VILSSHGERESKLGCATLVNITILKNDYPHGIIEFVSDGLSASIKESKGEDIYHA AVYGVIRTRGNFGAVNVSWMVSPDFTQDVFPVQGTVCFGDQEFF

KNITVYSLVDE IPEEMEEFTIILLNATGGAQTGIRTTASLRILRNDDPVYFAE EPCVLRVQEGETANFTVLRNGSVDGACTVQYATVDGKASGEEGDF

APVEKGETLVFEVGSREQSISVHVKDDGIPETDEPFYIVLFNSTG GDTVVYEYGVATVIIEANDDPNGVFSLEPIDKAVEEGKTNAFW WILRHRGHFG

NVSVAWQLFQNASLQPGQEFYETSGTVNFTDGEETKPVILRAFPDRIPEFNEFYILRLVNISG GPGGQLAETNFQVTVMIPFNDDPFGIFILDPECLER

EVAEDVLSEDDMSYITSFTILRQQGVFGDVRVGWEVLSREFTAGLPPMIDFILLGSFPSTVPLQPHMRRHHSGTDVLYFSGLEGAFGTVDPKYQPFRNNT

IANFTFSAWVMPNANTNGFLIAKDDSHGSIYYGVKIQTNETHVTLSLHYKTFGSNVTYIAKSTVMKYLEEGVWLHVLIILDDGIIEFYLDGKAMPRGIKS

LKGEAITDG GPGILRIGAGMDGGARFTGWMQDVRTYERKLTPEEIYELHAVPARTDLHPISGYLEFRQGESNKSFIVAARDDSEEEGEELFLLKLVSVD

GGAQISKENTTARLRIQKSDNANGLFGFTGACIPE MTEEGSTVSCVVERTRGALGYVHVFYTISQIESEGINYLVDDFANASGTITFLPWQRSE VLNL

YVLDEDMPELNEYFRVTLVSAVPGDGKLGSTPISGASIDPEKETTGITVKASDHPYG GLMQFSTGLPPQPEDSMSLPASSVPHITVQEEDGEIRLLVIR

AQGLLGRVTVGFRTVSLTAFSPEDYQ STAGTLEFQSGERYKYIFVNITDNSIPELEKSFKVELLNLDGGV VSDLFRVDGSGSGEADTDFFLPPVLPHA

 ASLGVASQILVTIAASDHAHGVFEFSPESLFVSGTEPEDGYSTVVLN VTRTRGALSAVTLQWKVDSDLDGDLAITSGNITFETGQRIASITVEILSDE

EPELDKALTVSILNVSSGSLGVLTNATLTILASDDPYGVFIFPNKTRPLSVEEATQNVTLSIIRLKGLMGEVAVSYATIDDMEKPPYFPPNLARATQGGD

YISASGLALFRANQTEATITISILDDAEPERSESVFIELFNSSLVDKVQNRPI IPHSPRLGPKVETVAHLVIVANDDAFGTVQLSATSVHVAENHVGPI

INVTRTGGTFADVSVKFKAVPITAAAG GEDYSIASSDVVLLEGETTKAVPIYIINDIYPELEETFLVQLLNETTGGATLGPLREAVITIEASDDPYGLF

G GFQNTKFIVEEPEFNSVRVNVPIIRNSGTLGNVTVQWVAIINGQFATGDLRVVSGNVTFAPGETIQTLLLEVLADDVPEIEE VVQVQLAAASGGGTI

GLDRVANIVIPANDNPYGSVAFVQSVFRVQEPLERSSYANITVRRS SGGHFGRLLLCYGTSDIDVVARAVEEGEDVLSYYESPTQGVPDPLWRTWVNVS

AVEETQYTCATLCLKERACSAFSVVSGAEGPRCFWMTSWVSGTVNSSDFQTYKKNMTRVASLFSGQAVAGSDYEPVTRQWAVILEGDEFANLTVSVLPDD

APEMDESFLISLLEVHLMNISDSFKNQPTIGHPNTSAVVIGLNGDAFGVFIIYSVSPNTSEDGLCVEVQEQPQTSVELVIYRTGGSLGQVMVEWRVVGGT

ATEGLDFMGAGDILTFAEG GETKKMAILTILDDSEPEDNESILVRLVATEGGSRILPSSDTVTVNILANDNVAGIVSFQTASRSVIGHEG GEMLQFHV

VRTPPGRGNVTVNWKVVGQNLEVNFANFTGQLFFSE GTLNKTIFVHLLDDNIPEEKEVYQVVLYDVKTQG GVSPAGVALLDAQGYAAVLTVEASDEPH

GVLNFALSSRFVVLQEANVTIQLFVNREFGSLG GAINVTYATVPGIVSLKNNTEGNLAEPESDFIPVVGSLVLEEGETTAAISITVLE DDIPELKEYF

LVNLTHVDLIMAPLTSSPPRLD DSEGLTAQIVIDANDGAQGMIEWQRNR RFEVNETDGVVTLVAQRSRAALGQVSLFMYAQNLEAQAGLDYMCTPQ I

LHFTDGERFKHVDVMILDDDMPEGDERFQLLLTNPSPGLELGKNTIA ALITVLANDDGPGVLSFNNSGHIFLREPTSLYVQESVAVLVIVREPAQGLFG

TVAVQFVVTEVNSSTESKDLSPSKGFIVLEEGVRSK TLRISAILDTEPEMDEHFVCTLFNPTGGARLGAHVQTLITIFQNQAPLGLFSISAVENS SAT

SIDVEESNRSVYLNVSRTNGLDLTASVQWETVSETAFGMR RGMDVVFSIFQSFFDKTALDWCFFTVEGSVYGVMLRKSSLVVYRWQGTFVPVE DLKVE

SPKTCEAFNIGVSPYLVITHGERSGEKPSINSVYMLTAGFRLVL IQTIIISGSCQVRHFTSDSQDYFIIASRRNDSELTQ VFRWNGNNFAWHQTLPVR

GVLGMALFSRGGSVFLAISQANIRQTSLLFTWSGTQFINFQELPISGITQVEALSSGDDVYLCFAKNTFLG GNQNAIDIFVWEMGHSSLRYFQSLDFAA

VKRIRSFTPASGIV VHILLTAQDGSALYCWNSELNAFSFVLEAPAAHDAAFVTVKSLNSSKTLIALVGATDSHLYELTYVSSQSDFIPS SLGELIFEP

GDKEAIIAVNVLDDTVPEKEESFRVQLKSPRGGAEIGINSSVRVTVLANDGAYGVVAFAQ NSLHKQLEELERDSLVTLNVERLRGTHGRITVAWEAAGS

VSDVFPTSGV ISFTEDQAMSMITLTVLADDLPELSEAVVVTLTQIVTEGVEDPLKGATIDQSRSRSVLTILPSDSPYGVVRWHTESLFNRVPEPTE EN

ITVVQLHIVRDKGLFGDISIHLIAKPNFLLHINNQATEDEDFVLQDSVIIMKENIKETHAEVAILP DEVPELDEGLIVTIAAVNLVNPNFPAEQPRVQR

PRMESAEILIEENDDPRGIFNFHVVR DVGGVIIAHEGPPPLNVLQVPVVRMAGTFETVNVYWKATPDSAGLEDFQPSHGMLQFADGQ VIAPILVTIID

DSEFELLETFTISLVSVTGGGRLGDDVSVNVVIAPNDSPFGIFGFEKKT VMVDGPLLSDDPDSYVTLTVVRSPGGKGAVRLHWAIEEKAKDDLSPLNGT

LYFDE TESQKSVILHTLKDGMVGEDRRFIIELTAADEVEISPVKG GSASVIIRGDKSISEVGIASSSRHIIIGEPSATYNGTAIID DLVRGPGVSGE

ITVNWKILPPSRGEFVETSGQLTMLDGQTAATVVIQ ALNDDIPEEKCHYEFQLTEISEGRMLHEASVSARITMVASDAPYGRFSFSHEQLHVSEAAQR 

VNVTVVRSGGSFGRARVLYETGSRTAEAGWDFVPASGELLFEAREKMKSLYIDILDDNLPEGPEEFVLAITRVDLQGR RGYDFTIQENGLQIDQPPEIG

NISIVRIIIMKNDNAEGIIEFDPKYTDISV VEEDAGVITLPVLRLHGTYGHVSADFSSRGFSAVPGGYVLHGSSVTFQHGQNLSFINVSIIDDNGS SE

FEKQFEILLIGATGGAILGRHLVSKITIAKSDSPFGIIRFLNQSKISLPNPSSTMALHLVLERTGGLLGEIQ VSWEVVGPDAEEPLPPHNGDFADPVSG

TVSFGDGEGGVRSIILRVCPHEETEAEETFIVQLKPLREAKLDPRAKAVTLT IQKFGDPNGVIHFAPESLSKRRFSEPPPSDGPLLVSFLVTRSKGTSG

DIK VHWELSSEFDITRDFLSTRGFFTIADGESDASFDVHLLPDDVPEIEEEYAVQLVSVEGGAELDLGKCTARFSVSANDDPHGVFALYSDRQSVLIGQ

NLDRSIQINITRLAGAFGAVAVRVQILSDNKEDPVATENEERQLVITDGARYKVGLVPLKNQ VFLSLGSNFTLQLVSVRLLSGPFYGIPTILQEAKNAI

LSVPEEAANSQ VGFESAAFQLMDIKAGTSQVMVSRKGTYGRLSVAWTTGYAPGSEIPEPIVIGNMTPTLG GSLSFVHGEERKGVLLWTFPSPGRPEAF

VLHLSGLRSSAAGGAQLR RSGFTTAEIEPMGVFQFSPSSRNITVSEDAQTIRICVQRLFGFHGDLIKVSYETTAGSAKPPEDFEAVQKGEVFFQRFQPE

IDFEITIINDQLPEIEETFYINLTSVETRGLGKGGVNWRPRLNPDLSVAVVTIVDNDDLTGVAVSVPVTAGTVAVDSTLLAMETGSTTHPNKSKITTIPY

TTEVFAPVTETVTVSAIPEKLATAHSVISVKPDVVPGTVLASVYGTLSIGPPIVYVSEEMKNGTLSTADILIQRMGGFAGNVTITVKTFGGRCAQKEPSV

WPFQDVYGVGNLTTWAFEEEDFEEQLLTLTFLYGERERKIAVQILDDDEPEGQEFFYVFLTDPQGGAEIVRGKDSTGFSAFAVIIISG GSDLHNGIIGF

SEESQRGLELREGADKNSQRLVVTRQPNR RAFEEVQIFWRVTLNQTVTILQEKGLNLTDELRFVAGVTTCTGGQTRCFIHLELNPKK VHQVEMPFFVE

LYDVTAGAAINNSARFAPIKLSKSGAPQSLVSFSVGSRLAVAHKKSTLISLQVARDSGTGIMMSVNFITQ ELRSAETVGRVLISPAVSGKDFVRTEGTL

VFEPGQKSAVLDVVLTPETGSLNKFPKRFQIVLFDPKGGARIDKVYGTANITLISDADSQAVWGLEDLLHQPLHEDILNRVLHNLNLRVATESTDEQLSA

VMLIMEK ITMEGRNQAFSIKSRTLLYELLCVLINPKRKDTRGFSHFVEVAEHFAFSLLTDVTCGSPGEK KSKTILDSCPYLSILALHWNPQQINGHKF

EGKEGDYIQIPERLLDVPEAEMLDGKNACTLVQFVEYSSQQWFIAGDNLPALKDK VLSLNVKGQSAQPLPNNNEVLYRIHAAEPRVVPHTSRCLLWNQA

AAS SWLSDSQFCKVVEDASDYVECACSHMSVYAVYAQTDNSSSYNEAFFSAGLICISG GLCLAVVSHMFCARHSMFAAKLLTHMMVASLGTQ ILFLA

SAYASPHLSEESCSAVAAVAHYLYLCQFSWMLIQ SVNFWYVLVVSDEHTERRCLLFCLLSWGLPSFVVILLILILRGIYHRSMPQIYGLIHGDL LCFI

PNIYAALFTAALVPLMCLVVVFVVFIHAYQLKPQWKGYDDVFRGRTNAAE EIPLILYLFALISMTWLWGGLHMAYRHFWMLVLFVIFNSLQ GLYVFVV

YFILHNQTCCPMKASYTVEMNGHPGPSTAFFTPGSGIPPAGEINKSTQNLINAMEE VPSDWERSSFQQTSQASPDLKTSPQNGASFPSSGGYGPGSLIA

DEESQEFDDLIFALKTG GAGLSVSDNESGQGSQEGGTLTDSQIVELRRIPIADTHL

For any suggestions or comments, please send an email to unitrap@crg.es